KEGG   Bos indicus (zebu cattle): 109571485
Entry
109571485         CDS       T04792                                 

Gene name
SELPLG
Definition
(RefSeq) P-selectin glycoprotein ligand 1
  KO
K06544  selectin P ligand
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109571485 (SELPLG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109571485 (SELPLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109571485 (SELPLG)
CD molecules [BR:biu04090]
 Proteins
  109571485 (SELPLG)
SSDB
Motif
Pfam: CCB2_CCB4
Other DBs
NCBI-GeneID: 109571485
NCBI-ProteinID: XP_019833559
Position
17
AA seq 427 aa
MFLQLLLLLALLGPGSSHQLGETSTNETVKAPGPLYPGEEXDPEXDEDYDYIGQTDPPEM
LDNITEVPKFLPMVTTLGQRESAGPMXPESFILEVSTRDSAVLSATGATTKKLSPKLVTP
VPLTKELVTEIPPKVKDPSTELAAATEALSTDPVTTEALSTEPRLTEALSTEPVATEVLS
TEPRLTEALSTEPAATEALSTEPRLTEALSTEPRLTEALSTEPAATESLSTEPKITETLP
TEPATTEAPFREPTTIPALPTDPTTVEALPTRTATTRGLTTALPVASYTPKGTTVAAGNL
SDDFTGNKHHSLFPWSSVAPLPADXLPDPGPVKQCLLAILILALLATIFLVCTVVLAIRL
SRKNHLYPVRDYSPSEMVCISSLLPERGEGPAPVPNGDLPKAREQGRKAGPREGREGDDL
TLHSFLP
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgtttctgcaactcctgctgcttctggccctgctgggccctggcagcagccaccagctg
ggggagaccagcacgaatgaaactgtgaaggccccaggccccctatacccaggtgaggag
asagacccagaagwcgatgaagactatgactatataggacaaacggaccctccagagatg
cttgacaatatcactgaggtccccaagtttctgcctatggtgacaacgctggggcagaga
gagtctgcagggcctatgaytcctgagtcattcattctggaggtgtccacaagggactct
gctgtcctgagtgccacaggggcaaccaccaaaaaactgagtccaaaactggtcacaccg
gtcccgctgaccaaagaactggttactgaaatccctcccaaagtgaaggatccatccaca
gagctggctgcagccacagaggccctgtccacagaccccgtgaccacagaggccctgtcc
acggaacccaggcttacagaagccctgtccacagaacccgtggccacagaggtcctgtcc
acggaacccaggcttacagaagccctgtccacagaaccygcagccacagaggccctgtcc
acggaacccaggcttacagaggccctgtccacagaacccaggcttacagaagccctgtcc
acagaacccgcagccacagagtccctgtccacagaacccaaaatcacagagactctgccc
acggaaccggccaccacagaagcccctttcagggagcccactaccataccagccctgccc
acagatccaaccactgtggaggccctgcccacgagaactgctaccacaaggggcctaacc
acagcccttcctgtggcctcttatactcccaagggcaccactgtcgcagctggcaacttg
tctgatgacttcactgggaacaaacatcatagcctttttccctggagctctgtggcccca
ctccccgcagacrgcctgccagacccgggccccgtgaagcagtgtttgctggccatcctc
atcctggccctgctggccaccatcttcctcgtgtgcaccgtggtgctggccatccgcctc
tcccgcaagaaccacctgtaccccgtgcgcgattactcccccagcgagatggtctgcatc
tcatctctgctgccygagcggggcgaggggcctgcgcccgtgcccaacggggacctgccc
aaggccagggaacagggccggaaggcggggccgagggagggccgtgaaggggatgacctc
accctgcacagcttcctcccttag

DBGET integrated database retrieval system