KEGG   Bos indicus (zebu cattle): 109571601
Entry
109571601         CDS       T04792                                 

Gene name
GLG1
Definition
(RefSeq) Golgi apparatus protein 1
  KO
K06816  golgi apparatus protein 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109571601 (GLG1)
SSDB
Motif
Pfam: Cys_rich_FGFR
Other DBs
NCBI-GeneID: 109571601
NCBI-ProteinID: XP_019833681
Position
18
AA seq 1082 aa
MVLPASLLRSQPSDLLTLVVCLVAPSPLPTHSAISANHSLLMSANHSLLPENEISSDCNH
LLWNYKLNLTTDPKFESVAREVCKSTISEIKECADEPFGKGYLVSCLVDHRGNITEYQCH
QYITKMTAIIFSDYRLICGFMDDCKNDINILKCGSIRLGEKDAHSQGEVVSCLEKGLVKE
AEERDPKIQVSELCKKAILRVAELSSDDFHLDRHLYFACRDDRERFCENTQAGEGRVYKC
LFNHKFEESMSEKCREALTTRQKLIAQDYKVSYSLAKSCKSDLKKYRCNVENLPRSREAR
LSYLLMCLESAVHRGRQVSSECQGEMLDYRRMLMEDFSLSPEIILSCRGEIEHHCSGLHR
KGRTLHCLMKVVRGEKGNLGMNCQQALQTLIQETDPGADYRIDRALNEACESVIQTACKH
IRSGDPMILSCLMEHLYTEKMVEDCEHRLLELQYFISRDWKLDPVLYRKCQGDASRLCHT
HGWNETSELMPPGAVFSCLYRHAYRTEEQGRRLSRECRAEVQRILHQRAMDVKLDPALQD
KCLIDLGKWCSEKTETGQELECLQDHLDDLAVECRDIVGNLTELESEDIQIEALLMRACE
PIIQNFCHDVADNQIDSGDLMECLIQNKHQKDMNEKCAVGVTHFQLVQMKDFRFSYKFKM
ACKEDVLKLCPNIKKKVDVVICLSTTVRNDTLQEVKEHRVSLKCRKQLRVEELEMTEDIR
LEPDLYEACKGDIKNHCSTVQYGNAQIIECLKENKKQLSPRCHQKVFKLQETEMMDPELD
YTLMRVCKQMIKRFCPEADSKTMLQCLKQNKNSELMDPKCKQMITKRQITQNTDYRLNPV
LRKACKADIPKFCHGILTKAKDDSELEGQVISCLKLRYADQRLSSDCEDQIRIIIQESAL
DYRLDPQLQLHCSDEIASLCAEEAAAQEQTGQVEECLKVNLLKIKTEGCKKEVLNMLKES
KADIFVDPVLHTACALDIKHHCAAITPGRGRQMSCLMEALEDKRVRLQPECKKRLNDRIE
MWSYAAKVAPADGFSDLAMQVMTSPSKNYILSVISGSICILFLIGLMCGRITKRVTRELK
DR
NT seq 3249 nt   +upstreamnt  +downstreamnt
atggtgctccctgcgtccttgctcagrtctcagccttctgacctcctcaccttggtggtg
tgccttgtcgccccctcacccctgcccacacacagcgccatatcagcaaatcacagyctc
ctcatgtcagcaaatcacagcctcctccctgaaaatgaaatttcttcagactgcaatcat
ttgttatggaattataagctgaacctaactacagatccaaaatttgaatctgtggccaga
gaagtttgcaagtctacaatatcagagatcaaagagtgcgctgatgagccatttggaaaa
gggtacctggtttcctgcttggtggatcaccgtggcaacatcaccgagtaccagtgccac
cagtacatcaccaagatgacagccatcattttcagtgactaccggctcatctgtggcttc
atggatgactgcaaaaatgacatcaacattctgaaatgcgggagcattcgccttggagaa
aaggatgcacattcacagggcgaggtggtatcatgcttggagaaaggcctggtgaaggaa
gcggaagaacgagaccctaagattcaagtctctgaactctgcaagaaagccattctccgg
gtggcagagctgtcctctgacgactttcacttggaccggcatttgtattttgcctgccga
gatgatcgggaacgtttttgygaaaatacacaagctggtgaaggcagagtatataagtgc
ctctttaaccataaatttgaagagtccatgagtgaaaaatgtcgagaagcactaacaacc
cgccagaagctgattgcccaggattataaagtcagttattcactggccaaatcctgtaag
agtgacttgaagaaataccggtgcaacgtggaaaaccttccccggtcccgggaagccagg
ctttcctaccttctgatgtgtctggagtcagctgtgcatagagggcggcaggtgagcagc
gagtgccagggggagatgctggactaccgccgcatgttgatggaagacttctctctgagc
cccgagatcatcctgagctgccgaggggagatcgagcaccactgctcggggctgcatcgg
aaagggcggaccctgcactgtctgatgaaggtggtgcggggggagaaggggaaccttgga
atgaactgccagcaggcgcttcaaacactgattcaggagactgaccctggtgcagattac
cgcattgatagagctttgaatgaagcttgtgaatctgtaatacagacagcctgcaaacac
ataagatccggagacccaatgatcctctcatgcctgatggaacatttatacacagagaaa
atggtggaagattgtgaacaccgtctcttagagctgcagtatttcatctcccgagattgg
aagctggaccctgtcttgtaccgcaaatgccagggagatgcatcgcgtctttgccacact
cacggttggaatgaaaccagtgaacttatgcctcccggagctgtgttctcctgcttatac
cgccatgcctaccgcactgaggagcagggcaggaggctctcacgggaatgccgagctgaa
gtccagaggatcctccaccagcgtgccatggatgttaagttggatcccgccctccaagac
aagtgcctgatcgatctggggaaatggtgcagtgagaaaacagagaccggacaggagctt
gaatgcctccaggatcatctcgatgacttagctgtggagtgcagagatatagttggcaac
ctcactgagttagagtccgaggatattcaaatagaagccttgctgatgagagcctgtgag
cccatcattcagaacttttgccacgatgtggcagataaccagatagactctggggacctg
atggagtgtctgattcagaacaaacaccagaaggatatgaacgagaagtgcgccgtcgga
gtcacccacttccagctggtgcagatgaaggattttcggttctcttacaagtttaaaatg
gcctgcaaggaggacgtgttgaagctttgccccaacataaagaagaaggtggacgtggtg
atctgcctgagcaccaccgtgcgcaacgacactctccaggaagtcaaggaacacagggtg
tccctgaagtgccgcaagcagctgcgggtggaggagctggagatgacagaggacatccgc
ctggaaccagatctgtatgaagcctgcaaaggtgacatcaagaaccactgctccactgtg
cagtatggcaacgcgcagattattgaatgtctgaaagaaaacaagaagcagctgagccct
cgttgccaccagaaagtgtttaagctgcaggagacagagatgatggacccagaactagac
tatacgctcatgagagtctgcaagcagatgataaagagattctgtccagaagcagattcc
aaaactatgttgcagtgtttgaagcaaaataaaaacagtgaattgatggatcccaaatgc
aaacagatgataaccaagcgccagatcacccagaacacagattaccgcttaaaccctgtg
ctaaggaaagcctgcaaagccgayatccctaaattctgtcatgggatcctgactaaggcc
aaggatgattcagagttagaaggtcaagtcatctcttgcctcaagctgagatatgcagac
cagcgcctctcttcagactgtgaggaccagatccggatcatcatccaggagtctgctctg
gattaccgcctggaccctcagctccagctgcactgctcggatgagatcgccagtctgtgc
gccgaggaagccgcagcccaggagcagaccggccaggtggaggagtgcctcaaggtcaac
ctgctcaaaatcaaaacagaaggctgtaaaaaggaagtgttaaacatgctgaaggaaagc
aaagcagacatcttcgtggacccggttcttcatacagcttgtgccctggacattaaacac
cactgtgcggccatcacccctggccgagggcgtcaaatgtcctgccttatggaggccctg
gaggacaagcgggtgaggttacaaccagagtgcaaaaaacgtctcaatgaccggattgaa
atgtggagttacgcagcaaaggtagccccagcggacggcttctctgacctcgccatgcaa
gtgatgacctccccgtccaagaactacatcctctctgtgatcagcgggagcatctgcata
ttgttcctgatcggcctgatgtgtggacgcatcaccaagcgcgtgacacgagagctcaag
gacaggtag

DBGET integrated database retrieval system