KEGG   Bos indicus (zebu cattle): 109571717Help
Entry
109571717         CDS       T04792                                 

Definition
(RefSeq) F-box only protein 17
  KO
K10101  F-box protein 17
Organism
biu  Bos indicus (zebu cattle)
Brite
KEGG Orthology (KO) [BR:biu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109571717
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:biu04091]
    109571717
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     109571717
Lectins [BR:biu04091]
 F-box lectins
  109571717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBA
Motif
Other DBs
NCBI-GeneID: 109571717
NCBI-ProteinID: XP_019833798
Position
18
AA seq 216 aa AA seqDB search
LARDRSAEGRALYSVAQRCPPNSEDEEEFPLCALARYCLRAPLGRNLIFNSCGEQGFRGW
EVEHGGNGWAVEKNLIMMPGAPSQTCFVTSFEWCFKRQLVDLVMEGVWQELLDSAQIEIC
VADWWGARENCGCIYRLRVRLLDVYENEVVKFSASPNPVLQWTERGCRQVSHVFTNFGKG
IRYVSFEQYGRDTRSWVGHYGTLVTHSSVRVRIRLS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
ctggctcgcgaccgcagtgcggagggccgcgccctctattcagtggcccagcgctgcccg
cccaacagcgaggatgaggaggagttcccgctatgcgctctggcgcgctactgcctgaga
gcgcccctaggccgcaacctcatcttcaactcctgcggagagcagggcttcagaggctgg
gaggtggagcacggcgggaatggctgggccgtggaaaagaayctcataatgatgccgggc
gctccttcccagacctgcttcgtgacttcgttcgaatggtgctttaagaggcagcttgtg
gacttggtgatggaaggggtgtggcaggagctgctcgacagcgcccaaatcgagatctgt
gtggccgactggtggggtgcccgggagaactgcggctgcatctaccggcttcgggtccgc
ctcctggacgtgtatgaaaatgaagtggtcaagttctcggcctcacccaacccggtcctt
cagtggactgaaagaggctgccgacaggtctcccacgtctttaccaactttggcaagggt
atccgctacgtgtcttttgagcagtatggaagagacacgcgttcctgggtggggcactac
ggcacccttgtgacccactccagtgtgagggtcaggatccgcctgtcctag

DBGET integrated database retrieval system