KEGG   Bos indicus (zebu cattle): 109571765
Entry
109571765         CDS       T04792                                 

Gene name
BBC3
Definition
(RefSeq) bcl-2-binding component 3
  KO
K10132  Bcl-2-binding component 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04115  p53 signaling pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04390  Hippo signaling pathway
biu05016  Huntington disease
biu05162  Measles
biu05200  Pathways in cancer
biu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109571765 (BBC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109571765 (BBC3)
   04215 Apoptosis - multiple species
    109571765 (BBC3)
   04115 p53 signaling pathway
    109571765 (BBC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109571765 (BBC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109571765 (BBC3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109571765 (BBC3)
  09172 Infectious disease: viral
   05162 Measles
    109571765 (BBC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109571765 (BBC3)
SSDB
Motif
Pfam: PUMA
Other DBs
NCBI-GeneID: 109571765
NCBI-ProteinID: XP_019833845
Position
18
AA seq 163 aa
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLC
APTAPPAVTAALGAPRWPGGPRSRPRGWWRVYASCLAALQPDPLARPTHLSGSSPSNFLS
APFPQRQEERQRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcccgagcacgccaggagggcagctccccggagcccgtagagggcctggcccgcgac
ggcccgcgccccttcccgctcagccgcctggtgccctcggcggtgtcctgcggcctctgc
gaacccggcctgcctgctgcccccgccgcccccgccctgctgcccgccgcgtacctctgc
gcccccaccgccccgcccgccgtcaccgccgccctgggggccccccgctggcctgggggt
ccccgcagccggccccgaggttggtggagggtctatgcctcctgcctcgctgcccttcag
cctgacccccttgcgcgccccacccacctgtccggctctagcccgtctaacttcctgtct
gctccctttccccagagacaagaggagcggcagcgacaccgcccctcaccctggagggtc
ctgtacaatctcatcatgggactcctgccctttcccgggggccgcggagcccccgaggtg
gagcccaattag

DBGET integrated database retrieval system