KEGG   Bos indicus (zebu cattle): 109571778
Entry
109571778         CDS       T04792                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu01524  Platinum drug resistance
biu04071  Sphingolipid signaling pathway
biu04115  p53 signaling pathway
biu04141  Protein processing in endoplasmic reticulum
biu04210  Apoptosis
biu04211  Longevity regulating pathway
biu04215  Apoptosis - multiple species
biu04217  Necroptosis
biu04722  Neurotrophin signaling pathway
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05016  Huntington disease
biu05020  Prion disease
biu05132  Salmonella infection
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05203  Viral carcinogenesis
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05216  Thyroid cancer
biu05217  Basal cell carcinoma
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109571778 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    109571778 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109571778 (BAX)
   04215 Apoptosis - multiple species
    109571778 (BAX)
   04217 Necroptosis
    109571778 (BAX)
   04115 p53 signaling pathway
    109571778 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109571778 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    109571778 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109571778 (BAX)
   05202 Transcriptional misregulation in cancer
    109571778 (BAX)
   05203 Viral carcinogenesis
    109571778 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109571778 (BAX)
   05212 Pancreatic cancer
    109571778 (BAX)
   05225 Hepatocellular carcinoma
    109571778 (BAX)
   05226 Gastric cancer
    109571778 (BAX)
   05214 Glioma
    109571778 (BAX)
   05216 Thyroid cancer
    109571778 (BAX)
   05220 Chronic myeloid leukemia
    109571778 (BAX)
   05217 Basal cell carcinoma
    109571778 (BAX)
   05218 Melanoma
    109571778 (BAX)
   05213 Endometrial cancer
    109571778 (BAX)
   05224 Breast cancer
    109571778 (BAX)
   05222 Small cell lung cancer
    109571778 (BAX)
   05223 Non-small cell lung cancer
    109571778 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109571778 (BAX)
   05014 Amyotrophic lateral sclerosis
    109571778 (BAX)
   05016 Huntington disease
    109571778 (BAX)
   05020 Prion disease
    109571778 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109571778 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109571778 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109571778 (BAX)
   05152 Tuberculosis
    109571778 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109571778 (BAX)
   05170 Human immunodeficiency virus 1 infection
    109571778 (BAX)
   05162 Measles
    109571778 (BAX)
   05164 Influenza A
    109571778 (BAX)
   05161 Hepatitis B
    109571778 (BAX)
   05160 Hepatitis C
    109571778 (BAX)
   05168 Herpes simplex virus 1 infection
    109571778 (BAX)
   05163 Human cytomegalovirus infection
    109571778 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109571778 (BAX)
   05169 Epstein-Barr virus infection
    109571778 (BAX)
   05165 Human papillomavirus infection
    109571778 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109571778 (BAX)
   01524 Platinum drug resistance
    109571778 (BAX)
   01522 Endocrine resistance
    109571778 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:biu03029]
    109571778 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:biu02000]
    109571778 (BAX)
Mitochondrial biogenesis [BR:biu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    109571778 (BAX)
Transporters [BR:biu02000]
 Other transporters
  Pores ion channels [TC:1]
   109571778 (BAX)
SSDB
Motif
Pfam: Bcl-2 CF222
Other DBs
NCBI-GeneID: 109571778
NCBI-ProteinID: XP_019833858
Position
18
AA seq 174 aa
MKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLSECLKRIGDELDSNMELQRM
IAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKVGGCRALSPGRLPSGL
RGPGSHEVNPRDSPETTEGMERVSYGPLISFFIHVFIHSAWASLVAQMVGTKEP
NT seq 525 nt   +upstreamnt  +downstreamnt
atgaagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatgggg
ggagagacacccgagctgggcttggagcaggtgccccaggatgcatccaccaagaagctg
agcgagtgtctgaagcgcatcggagatgaattggacagtaacatggagctgcagaggatg
atcgcagctgtggacacagactctccccgagaggtctttttccgagtggcggctgaaatg
ttttctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaa
ctggtgctcaaggtgggcggctgcagggccctgagcccagggaggctcccttcaggcctg
agaggacctgggagtcatgaggtcaaccctcgggacagcccggaaaccacagagggaatg
gagagagtcagctatgggccactcatcagctttttcattcatgtatttattcactcagca
tgggcttccctagtggctcagatggtaggtaccaaggagccataa

KEGG   Bos indicus (zebu cattle): 109571977
Entry
109571977         CDS       T04792                                 

Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu01524  Platinum drug resistance
biu04071  Sphingolipid signaling pathway
biu04115  p53 signaling pathway
biu04141  Protein processing in endoplasmic reticulum
biu04210  Apoptosis
biu04211  Longevity regulating pathway
biu04215  Apoptosis - multiple species
biu04217  Necroptosis
biu04722  Neurotrophin signaling pathway
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05016  Huntington disease
biu05020  Prion disease
biu05132  Salmonella infection
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05203  Viral carcinogenesis
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05216  Thyroid cancer
biu05217  Basal cell carcinoma
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109571977
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    109571977
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109571977
   04215 Apoptosis - multiple species
    109571977
   04217 Necroptosis
    109571977
   04115 p53 signaling pathway
    109571977
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109571977
  09149 Aging
   04211 Longevity regulating pathway
    109571977
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109571977
   05202 Transcriptional misregulation in cancer
    109571977
   05203 Viral carcinogenesis
    109571977
  09162 Cancer: specific types
   05210 Colorectal cancer
    109571977
   05212 Pancreatic cancer
    109571977
   05225 Hepatocellular carcinoma
    109571977
   05226 Gastric cancer
    109571977
   05214 Glioma
    109571977
   05216 Thyroid cancer
    109571977
   05220 Chronic myeloid leukemia
    109571977
   05217 Basal cell carcinoma
    109571977
   05218 Melanoma
    109571977
   05213 Endometrial cancer
    109571977
   05224 Breast cancer
    109571977
   05222 Small cell lung cancer
    109571977
   05223 Non-small cell lung cancer
    109571977
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109571977
   05014 Amyotrophic lateral sclerosis
    109571977
   05016 Huntington disease
    109571977
   05020 Prion disease
    109571977
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109571977
   04933 AGE-RAGE signaling pathway in diabetic complications
    109571977
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109571977
   05152 Tuberculosis
    109571977
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109571977
   05170 Human immunodeficiency virus 1 infection
    109571977
   05162 Measles
    109571977
   05164 Influenza A
    109571977
   05161 Hepatitis B
    109571977
   05160 Hepatitis C
    109571977
   05168 Herpes simplex virus 1 infection
    109571977
   05163 Human cytomegalovirus infection
    109571977
   05167 Kaposi sarcoma-associated herpesvirus infection
    109571977
   05169 Epstein-Barr virus infection
    109571977
   05165 Human papillomavirus infection
    109571977
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109571977
   01524 Platinum drug resistance
    109571977
   01522 Endocrine resistance
    109571977
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:biu03029]
    109571977
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:biu02000]
    109571977
Mitochondrial biogenesis [BR:biu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    109571977
Transporters [BR:biu02000]
 Other transporters
  Pores ion channels [TC:1]
   109571977
SSDB
Motif
Pfam: Bcl-2 CF222
Other DBs
NCBI-GeneID: 109571977
NCBI-ProteinID: XP_019834062
Position
18
AA seq 173 aa
MKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLSECLKRIGDELDSNMELQRM
IAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGW
TLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
NT seq 522 nt   +upstreamnt  +downstreamnt
atgaagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatgggg
ggagagacacccgagctgggcttggagcaggtgccccaggatgcatccaccaagaagctg
agcgagtgtctgaagcgcatcggagatgaattggacagtaacatggagctgcagaggatg
atcgcagctgtggacacagactctccccgagaggtctttttccgagtggcggctgaaatg
ttttctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaa
ctggtgctcaaggccctgtgcaccaaggtgcccgagttgatcaggaccatcatgggctgg
acattggacttccttcgagagcggctgctgggctggatccaggaccagggtggttgggac
ggcctcctctcctactttgggacacccacatggcagacagtgaccatctttgtggctgga
gtgctcaccgcctcgctcaccatctggaagaagatgggctga

DBGET integrated database retrieval system