KEGG   Bos indicus (zebu cattle): 109571901
Entry
109571901         CDS       T04792                                 

Gene name
LRRC4B
Definition
(RefSeq) leucine-rich repeat-containing protein 4B
  KO
K16360  netrin-G3 ligand
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109571901 (LRRC4B)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 I-set Ig_3 ig LRR_9 V-set LRRNT Ig_2 LRR_1 Ig_6
Other DBs
NCBI-GeneID: 109571901
NCBI-ProteinID: XP_019833973
Position
18
AA seq 711 aa
MARARGSLCPPLPPGRMSWPHGALLFLWLFSPPLGAGGGGMAVTSAAGXXAPPATSCPAA
CSCSNQASRVICTRRELAEVPASIPVNTRYLNLQENGIQVIRTDTFKHLRHLEILQLSKN
LVRKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAFNR
VPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNR
LDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFTPL
HRLERVHLNHNPWHCNCDVLWLSWWLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFT
CYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGT
LNFTNVTVQDTGQYTCMVTNSAGNTTASATLNVSAVDPVAAGSAGSAGGGGGGVPGGGGG
GYTYFTTVTVETLETQPGEEALQPRGTEKEPPGPTTDGVWGGGRPGEGAGQASSSTTAPA
PRSSRPTEKAFTVPITDVTENALKDLDDVMKTTKIIIGCFVAITFMAAVMLVAFYKLRRQ
HQLHKHHGPTRTVEIINVEDELPAASAVSVAAAAAVAGGGGVGGDSHLALPALERDHLNH
HHYVAAVFKAHYSSNPSGGGCGGKGPPGLNSIHEPLLFKSGSKENVQETQI
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggcgcgcgcccgcggctccctgtgccccccactgccgcccggtaggatgtcctggccc
catggggccctgctgttcctctggctcttctccccgcccctgggggccggcgggggcggc
atggccgtgacatccgctgccggannnnnngccccgccggccacctcctgccccgcggcc
tgctcctgcagcaaccaggccagtcgggtgatctgcaccaggagagagctggccgaagtt
ccggccagcatccctgtcaacacgcggtacctgaacctgcaggagaacggcatccaggtg
atccggacggacacgttcaagcaccttcggcacctagagatcctacagctgagcaagaac
ctggttcgcaagatcgaggtgggcgccttcaacgggctgcccagcctcaacaccctggaa
ctgttcgacaaccggctgacgacggtgcccacgcaggccttcgagtacctgtccaagctg
cgtgagctctggctgcggaacaaccccatcgagagcatcccgtcgtacgccttcaaccgc
gtgccctcgctccgccgcctcgacctgggcgagctcaagcggctggagtacatctcggag
gcggccttcgaaggcctggtgaacctgcgctacctcaacctgggcatgtgcaacctcaag
gacatccccaacctgacggccctggtgcgcctggaggagctggagctgtctggcaaccgg
ctggacctcatccgcccgggctccttccagggcctgaccagcctgcgcaagctgtggctg
atgcacgcccaggtggccaccatcgagcgcaacgccttcgacgacctcaagtcgctggag
gagctcaacctgtcccacaacaacctgatgtcgctgccccacgacctcttcacgcccctg
caccgcctggagcgcgtccacctcaaccacaacccctggcactgcaactgcgacgtgctg
tggctcagctggtggctcaaggagacggtgcccagcaacacgacgtgctgcgcgcgctgc
cacgcgcccgccggcctcaaagggcgctacatcggtgagctggaccagtcgcacttcacc
tgctacgcgccggtcatcgtggagccgcccacggacctcaacgtcaccgagggcatggcc
gccgagctcaagtgccgcacgggcacgtccatgacctccgtcaactggctgacgcccaac
ggcaccctcatgacccacggctcgtaccgcgtgcgcatctccgtcctccacgacggcacg
ctcaacttcaccaacgtcactgtgcaggacacgggccagtatacctgcatggtgacgaac
tcggccggcaacaccacagcctcggccacactcaacgtctcggccgtggaccccgtggcg
gctggaagtgccggcagcgcgggcggcggcggtgggggcgtccccggaggcggaggcggc
ggctacacctacttyaccaccgtgacggtggagaccctggagacgcagcctggagaggag
gctctgcagccgcgcgggaccgagaaggagccgccggggcccacgacagacggcgtctgg
ggcgggggccggcccggggagggggcaggccaggcctcctcgtccaccacggcgcccgcc
ccgcgctcctcgaggcccacggagaaggcgttcaccgtgcccatcacggacgtgacggag
aacgccctcaaggacctggatgacgtcatgaagaccaccaagatcatcatcggctgcttc
gtggccatcacgttcatggccgccgtgatgctsgtggccttctacaagctgcgcaggcag
caccagctgcacaagcaccacgggcccacgcgcacggtggagatcatcaacgtggaggac
gagctgcccgccgcctccgccgtgtccgtggccgccgccgccgccgtggcgggcgggggc
ggcgtgggcggggacagccacctggccctgcccgcgctggagcgcgaccacctcaaccac
caccactacgtggcggctgttttcaaggcgcactacagcagcaaccccagcggcgggggc
tgcgggggcaagggcccgcccggcctcaactccatccacgaacctctgctcttcaagagc
ggctccaaggagaacgtgcaagagacgcagatctga

DBGET integrated database retrieval system