KEGG   Bos indicus (zebu cattle): 109572327
Entry
109572327         CDS       T04792                                 

Gene name
CD22
Definition
(RefSeq) B-cell receptor CD22 isoform X1
  KO
K06467  CD22 antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04640  Hematopoietic cell lineage
biu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109572327 (CD22)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109572327 (CD22)
   04662 B cell receptor signaling pathway
    109572327 (CD22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109572327 (CD22)
   04091 Lectins [BR:biu04091]
    109572327 (CD22)
CD molecules [BR:biu04090]
 Proteins
  109572327 (CD22)
Lectins [BR:biu04091]
 I-type lectins (Siglecs)
  109572327 (CD22)
SSDB
Motif
Pfam: Ig_2 Ig_3 I-set ig V-set Ig_4 Ig_5 C2-set_2 Ig_6 C1-set Izumo-Ig C2-set PKD
Other DBs
NCBI-GeneID: 109572327
NCBI-ProteinID: XP_019834578
Position
18
AA seq 928 aa
MDGWKKGRSASPTWCWADGRGMAYPEKAHELLEFPILLCNQSLFSGDQGKGVGIGAQEEL
SGRCQRPGGSKTNSSWPRLLPRHSTMHLLGPSLLLLEYLAFSDSAWNFRHPKTLYAWDGA
CVWIPCTYSSVKGGGHTLDNLTVYHNFTYDKKTKHYNGTILYNKSLKTKESTPSQERVQF
LGNNRNNCTLLINPVKVNDSGLLGLRVTSGTDKWMASLNLSISESAPQPHIELHQEIRED
QEVTVTCSLNFACRDYQVHLQWSLEGSVTTSTILSPERVATQSHLSFQPKWTHDGKNLTC
QLWDPMKQRILSEKTVLLEVKHAPNLEIQVSPQEAIVTEGESVTMRCQVISSNPPHWSVS
WFKDRTKLKEQGTTLVLPEVTRTMSGQYTCQVSNDVGSRQSDVVDLQVHYPPEPSWVQLS
PSSIKEGVTVELTCMSVANPPPANYTWYFNEQEIPGKNGRTFQIPQVLVKHAGRYSCLAE
NSLGPGSVDREADLNVQYPPKGVTTVIQNPTPIREGDSVTLSCTFNSSNPRVTRYNWNSP
GSQDHTSQKLTIQKVTWDAQPVKCEACNQWCSWSPSVNLNVLYAPRDVNIQISPNTEIQS
EKRVLLQCQYSSSRPADVHFFWKKDGSLLKEGKTLTFGQIFPEDSGTYHCLVNNSIGQTS
SKAYELQVLYAPRRLRVSISPKDGVVEGKTAVLTCESDANPPISHYDWFDGKNQDLHYYG
QMLRLEPVKLQHAGSYWCRGTNRLGQSQSPPTTLTVYYSAATISRRAALGVGFCLAIFLL
AIWGVKLQRSWKRIQRQQGLQESSSGQSFFVRNLKARRTPQAERPASLGCYNPVMEDAVS
YATLSFPLGETDTRRLRDAGSSEMREIPPSRDDRVTYAVVQNCQVADYENVTPEVLDDEG
IHYSELVHFGNGKRALAQEGVEYVTLKH
NT seq 2787 nt   +upstreamnt  +downstreamnt
atggatggttggaagaaaggaagaagtgctagtcctacatggtgttgggctgatgggaga
ggcatggcatatcctgaaaaggcccatgagcttctggaattccctatcctgctgtgcaac
cagtcactgttctctggggatcagggaaaaggggttggcataggtgcgcaagaagagctg
tctggaagatgtcagcgaccaggtggctcaaagacaaactcttcctggcccaggctcctg
cctagacacagcaccatgcatctccttggcccctcgctcctgcttctcgaatacttggct
ttctctgactcagcctggaactttaggcatcctaagaccctctatgcctgggatggagcc
tgcgtctggatcccttgcacatacagttcggtaaagggtggtggacacaccctagataac
ctgactgtgtaccacaattttacgtatgacaagaagaccaagcactacaacgggaccatc
ctctataataagagcctgaaaaccaaggagtctacccccagtcaggaaagggtacaattc
ttgggaaacaacagaaacaattgtacccttctcatcaatcctgtcaaagtcaatgacagc
ggccttctggggctgagggtgacatcggggactgacaaatggatggcatctctaaacctc
agcatctctgagagtgctcctcaaccccacatagagctccatcaggaaatccgggaggac
caggaagtcactgtcacctgctcactgaatttcgcctgccgtgattaccaggtccatttg
cagtggtccctggaggggtctgtgaccacctctaccatcctctccccggagagggtcgcc
acccagagccacctcagtttccagcccaagtggactcatgatggcaagaacctgacctgc
cagctctgggaccccatgaaacagcggatactctcggagaaaacggtgttgctggaagtg
aagcacgcaccaaatttggagatccaggtcagcccccaagaagccatcgtcacagagggc
gagtctgtgaccatgaggtgccaggtcatcagcagcaacccgccgcactggagtgtgtcc
tggttcaaggacaggacaaaactgaaggagcaggggacaacactcgttctgcccgaagtg
accaggacgatgagcgggcagtacacgtgccaggtctccaatgatgtgggctcaagacag
tcagatgtggtggatctccaggtgcactatcctccagaaccttcctgggttcagctctcc
ccctcgtcaattaaagaaggagttacagtagagctgacttgtatgtcagtagccaatcct
cctccagcgaattacacctggtacttcaatgagcaagaaatacccggaaagaacggcagg
accttccagatccctcaagtcctcgtcaagcatgctgggaggtactcctgcttggcagaa
aatagtcttgggcctggatctgttgaccgggaagctgacttgaacgtccagtatcccccc
aagggggtcaccacggtgattcaaaaccccacaccgattcgagaaggagacagtgtgacc
ctgtcctgcaccttcaattccagtaaccccagagttactcgatataactggaatagccca
ggctcccaggaccatacatcacagaagctgacgattcaaaaagtcacctgggatgcacag
ccagtcaaatgcgaagcctgtaaccagtggtgttcgtggtctccctctgtcaacctgaac
gtcctctatgcccccagggacgtcaacattcagatcagccctaatacagagattcaatct
gagaagcgggtcctcctccagtgtcaatactcaagtagccgtcccgcggacgtccacttc
ttctggaagaaagatggaagccttctgaaggaagggaagacacttacctttggccaaatc
tttccagaagattcgggaacctaccactgcttggtcaacaactccataggacagacctca
tctaaggcctatgagctccaagtgctgtatgctcccaggaggctgcgtgtgtccatcagc
ccgaaagacggggtggtggaggggaagacggcagtcctgacctgtgagagtgacgccaac
cctcccatctcccactacgactggtttgatgggaaaaaccaagaccttcactattacggt
cagatgctgaggttggagcctgtgaagctgcagcatgcaggcagctactggtgccggggg
accaaccgtctgggccagagccagtcaccccccaccaccctcactgtctactacagtgct
gccaccatcagcaggcgtgcggccttgggagtggggttctgcctggccatcttccttctg
gccatctggggagtcaagcttcagcggagttggaagaggattcagagacagcagggcctt
caagaaagttccagtggacagagcttctttgtgaggaatttaaaggctagaaggaccccc
caagccgaacgccccgcctccctggggtgctacaacccggtgatggaagatgcrgtcagc
tatgctaccttgagctttcctcttggcgagactgacactcggagacttagagacgcaggg
agctcagagatgcgggaaattcccccaagcagggacgacagggtcacctatgctgtggtg
cagaactgtcaagtggccgactatgagaacgtgactccggaggtcctagatgatgagggc
attcattactcggagctggtccattttgggaatgggaagcgggcactggcccaggaagga
gtggaatacgtgaccctcaagcactga

DBGET integrated database retrieval system