KEGG   Bos indicus (zebu cattle): 109572349
Entry
109572349         CDS       T04792                                 

Gene name
MAG
Definition
(RefSeq) myelin-associated glycoprotein
  KO
K06771  myelin associated glycoprotein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109572349 (MAG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109572349 (MAG)
   04091 Lectins [BR:biu04091]
    109572349 (MAG)
Cell adhesion molecules [BR:biu04515]
 Immunoglobulin superfamily
  MAG
   109572349 (MAG)
Lectins [BR:biu04091]
 I-type lectins (Siglecs)
  109572349 (MAG)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig V-set C2-set_2 Ig_5 Ig_C17orf99 Izumo-Ig
Other DBs
NCBI-GeneID: 109572349
NCBI-ProteinID: XP_019834636
Position
18
AA seq 580 aa
MIFLTALSLFWIMISASRGGQWGAWMPSSISAFEGTCVSIPCRFSFPDELRPAVVHGVWY
FNSPYPKNYPPVVFKSRTQVVHESFQGRSRLLGDLGLRNCTLLLSNLSPELGGKYYFRGD
LGGYNQYTFSEHSVLDIINTPNIVVPPEVMAGTEVEVSCMVPDNCPELHPELSWLGHEGL
GEPTVLGRLREEEGTWVQVSLLHFVPTRETNGHRLGCQASFPNTTLQFEGYASLDIKYPP
VIVEINSTVEAIEGSHVSLFCGADSNPPPLLTWMRDGTVLREAVXESLSLEVDEVTPAED
GVYLCLAENTYGQDNRTVELSVMYAPWKPMVNGTVVAVEGETVSILCSTQSNPDPILTIF
KEKQILATVIYESELQLELPAVTPEDDGEYWCVAENQYGQRATAFNLSVEFAPVILLESH
CAAARDTVQCLCVVKANPEPSVAFELPLRNVTVNETEREFVYSERSGLLLTSILTLRGQA
QAPPRVICTSHNLYGTKSLELPFQGAHRLMWAKIGPVGAVVAFAILIAIVCYITQTRRKK
NVTESPSFSGGDNPPVVFSSDFRISGAPEKYESREVSTLE
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgatattcctcacggcactgtctctattttggattatgatttcagcctctcgtgggggt
cagtggggcgcctggatgccatcgtccatctcggcctttgagggcacgtgcgtctccatc
ccctgccgcttcagcttccctgatgagctgcggccggccgtcgtgcatggcgtttggtac
ttcaatagcccctatccgaaaaactaccctccggtggtcttcaagtcacgcacgcaggtg
gtgcacgagagcttccagggacgcagccgcctcctgggggacctgggcctgcgcaactgc
accctcctgctcagcaacctaagccccgagctgggcggcaaatactactttcgaggggac
ctggggggctacaaccagtacaccttctccgagcacagcgtcctggacatcatcaacacc
cccaacatcgtggtccccccggaagtgatggctggcacagaagtggaggtcagctgcatg
gtgcctgacaactgcccggagctgcacccagagctgagctggctgggccacgaggggctc
ggtgagccgactgtgctggggcggctgcgcgaggaggagggtacctgggtgcaggtgtcg
ctgctgcactttgtgcccaccagggagaccaacggccaccggctgggctgccaggcctcg
ttccccaacactaccctgcagttcgagggctacgccagcctggacatcaagtaccccccg
gtgatcgtggagataaactccacrgtggaggccatcgagggctcccacgtcagcctgttc
tgcggggccgacagcaacccgccgccgttgctgacctggatgcgggatggcacggtgctc
cgcgaggccgtggycgagagcctgtccctkgaggtggacgaagtgacccctgccgaagac
ggcgtctacctctgcctggctgagaacacctacggccaggacaaccgcaccgtagagctc
agcgtcatgtatgcaccctggaagccgatggtgaacgggacagtggtggccgtggagggc
gagacagtctccatcttgtgctccacacagagcaacccggatcctattctcaccatcttc
aaggagaagcagattctggccacggttatctatgagagtgagctgcagctggagctgccg
gccgtcacccctgaggacgacggagagtactggtgtgtggccgagaaccagtatggccag
agggccaccgccttcaacctgtctgtggagttcgctcctgtgatcctattggagtcccac
tgtgcggcagcccgtgacacagtgcagtgcctctgtgtggtgaaagccaacccagagccc
tccgtggccttcgagctgcccttgcgcaacgtgacggtgaacgagacagagcgcgagttc
gtgtactcagagcgcagcggcctcctgctcaccagcatcctgacgctgcgggggcaggcc
caggccccaccccgggtcatctgcacctcccacaacctctacggcaccaagagcctggag
ctgcccttccagggagcccaccgcctcatgtgggccaagatcgggcctgtgggagccgtg
gtggcctttgccatcctaatcgccatygtgtgctacatcacccagacgcgcagaaaaaag
aacgtgacggaaagccccagcttctcggggggagacaaccccccsgtcgtgttcagcagc
gacttccgcatctccggggcgccggagaaatatgagtccagagaggtctctaccctggaa
tga

DBGET integrated database retrieval system