KEGG   Bos indicus (zebu cattle): 109572519
Entry
109572519         CDS       T04792                                 

Gene name
TRADD
Definition
(RefSeq) tumor necrosis factor receptor type 1-associated DEATH domain protein isoform X1
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04064  NF-kappa B signaling pathway
biu04071  Sphingolipid signaling pathway
biu04210  Apoptosis
biu04217  Necroptosis
biu04622  RIG-I-like receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04668  TNF signaling pathway
biu04920  Adipocytokine signaling pathway
biu05132  Salmonella infection
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109572519 (TRADD)
   04064 NF-kappa B signaling pathway
    109572519 (TRADD)
   04668 TNF signaling pathway
    109572519 (TRADD)
   04071 Sphingolipid signaling pathway
    109572519 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109572519 (TRADD)
   04217 Necroptosis
    109572519 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109572519 (TRADD)
   04657 IL-17 signaling pathway
    109572519 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109572519 (TRADD)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109572519 (TRADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109572519 (TRADD)
   05152 Tuberculosis
    109572519 (TRADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109572519 (TRADD)
   05162 Measles
    109572519 (TRADD)
   05164 Influenza A
    109572519 (TRADD)
   05160 Hepatitis C
    109572519 (TRADD)
   05168 Herpes simplex virus 1 infection
    109572519 (TRADD)
   05163 Human cytomegalovirus infection
    109572519 (TRADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109572519 (TRADD)
   05169 Epstein-Barr virus infection
    109572519 (TRADD)
   05165 Human papillomavirus infection
    109572519 (TRADD)
SSDB
Motif
Pfam: TRADD_N Death TPR_14
Other DBs
NCBI-GeneID: 109572519
NCBI-ProteinID: XP_019834938
Position
18
AA seq 321 aa
MLISVPRSKMAAGPNGLEEWVGSAYLFVESSLDKVVLSDAYAHQQQKVAMYGALQTALAE
SGGSPDVLQMLKIHRSDPQLIVQLRFSGRQACSRFLRAYREGALRATLQGCLARALALNS
VPLQLELRAGAEQLDALLTNEERCLNCICAQKPDRLRDEELTELENALRNLTCGSAGGQG
SDVQGTPAPLQSLAPSPPEEKPPPPQPGQTFLFQGQPIVNRPLNLQDQQKFARSVGLKWR
KVGRSLQRSCRALRDPALDSLAYEYERDGLYEQAFQLLRRFVQAEGRRATLQRLVEALEE
NELTSLAEDLLGLANPDGSLA
NT seq 966 nt   +upstreamnt  +downstreamnt
atgcttatctctgtccccaggagcaagatggcggctgggccaaatgggcttgaggagtgg
gtgggcagcgcatacctgtttgtggagtcctcactggacaaagtggtcttgtccgatgcc
tacgctcaccagcagcagaaagtggcaatgtacggggctctccagactgccctagcagag
agtggcgggagccccgacgtgctgcagatgctcaagatccaccgcagcgatccgcagctg
atcgtgcaactgcgtttcagcgggcgccaggcgtgcagccgcttcctccgcgcctaccgc
gagggggcgctaagagccacgctgcaagggtgcctggctcgggcactggccctgaactcg
gtgccactgcaactggagctgcgcgctggcgccgagcagctggatgccttgctgaccaac
gaggagcgctgtttgaactgcatatgcgcccagaagcctgaccggctccgggatgaggaa
ctcaccgagttggagaatgcgctcaggaatctgacgtgcggttcggcggggggccaagga
agcgacgtgcaaggcactccagcccccttgcagtctctggcaccttctccgccggaggaa
aaaccgccaccaccgcagcctggccagacttttttgttccagggtcagcccatagtgaac
cggccgttgaacctgcaggatcaacagaagttcgcccgctcagtgggcctcaagtggcgc
aaggtggggcgctctctgcagcgcagctgccgcgcgctgcgggacccggcgctggactca
ctggcctatgaatacgagcgcgacgggctgtacgagcaggccttccagctgctgcggcgc
tttgtgcaggccgagggccgccgcgccacgctgcagcgcctggtggaggcgctcgaggag
aacgagctcaccagcctggcggaggacttgctgggcctggcgaatcctgacggcagcctg
gcctag

DBGET integrated database retrieval system