KEGG   Bos indicus (zebu cattle): 109572531
Entry
109572531         CDS       T04792                                 

Definition
(RefSeq) cadherin-3-like isoform X1
  KO
K06796  cadherin 3, type 1, P-cadherin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109572531
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109572531
Cell adhesion molecules [BR:biu04515]
 Cadherins
  Major cadherins
   109572531
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_2 Cadherin_3 BACON_2 Big_9
Other DBs
NCBI-GeneID: 109572531
NCBI-ProteinID: XP_019834958
Position
18
AA seq 804 aa
MDSRGRNPXTCLSRTWLRLKSDASKEEGLTAKLITSRGSXLPCCEDAQAALWSGLRRTEA
SCQQFQLASHAQVYWLPRAASEPCRAGFGEAEVTLEARGAELEPGQALGKVVFTDCPGQX
SALLTDDDFIVLNDETVQERKALKISPPAPVLRRRKREWVVPPISVPENGKGPFPQRLNQ
LKSNKDRGTKIFYSITGPGADSPPEGIFAIEKETGWLLLNKPLDREKIAKYELFGHAVSE
NGASVEDPMNISIIVTDQNDHKPKFTQDVFRGSVLEGVLPGTSVMQVTATDEDDAVNTYN
GVVAYSIHSQEPKDPNDLMFTVHRSTGTISVISSGLDRERVPEYTLTIHATDMDGDGSST
TAMAIVEILDANDNAPVFDPQKYEARVPENTVSHEVQRLTVTDLDAPNSPAWRATYRIVG
GDNGDHFTITTDPESNQGILTTQKGLDFEAKTQHTLYVEVINEVPFVVKLPTSTATVVVL
VEDVNEPPVFVPPSKVIEIQEGISTGEPICAYTARDPDKGSQKISYHILRDPAGWLAMDP
DSGQVTAAGVLDREDEQFVRNNIYEVMVLATDDGDAVALSLKKFLKQGEYDVHLSLSDHG
NKEQLTVIRATVCDCHGNMVTCRDPWTWGFLLPILGAALALLLLLLVLLFLVRKKRKIKE
PLLLPEDDTRDNVFYYGEEGGGEEDQDYDITQLHRGLEARPEVVLRNDVAPSFIPTPMYR
PRPANPDEIGNFIIENLKAANTDPTAPPYDSLLVFDYEGSGSDAASLSSLTSSTSDQDQD
YNYLNEWGSRFKKLADMYGGGQDD
NT seq 2415 nt   +upstreamnt  +downstreamnt
atggatagcagagggagaaatccaamgacctgtctgtccagaacttggctaagattaaag
agtgatgcatcaaaggaagagggattaactgctaaactcatcacatccaggggaagcygg
ctgccatgctgtgaggacgctcaagcagccctatggagtggtctaagaagaactgaggcc
tcctgccaacagttccaacttgccagccatgcacaggtttactggctgccgcgcgcggcc
tcggaaccgtgccgggcaggcttcggggaagctgaagtgaccttggaggcgcgaggcgcg
gagctggagccgggccaggcgctgggaaaagtggtcttcacagactgccctgggcaagas
tcggccctgctgactgacgatgacttcattgttctgaacgatgaaacagtccaggaaagg
aaagcactgaagatctccccacccgcacctgtcttacgaaggcgcaagagagaatgggtg
gtcccgccaatatctgtgcctgagaatggcaagggtcctttcccccagaggctgaatcag
ctcaaatctaataaggacagaggcaccaagattttctacagcatcacggggcctggggca
gacagcccaccagagggtatctttgctatagagaaggaaacaggctggttgttgctgaat
aagccactggaccgggagaagattgccaagtatgagctctttggccatgctgtatcagag
aacggcgcctctgtggaagatcccatgaacatctccatcattgtaacagaccagaatgac
cacaagcccaagttcacccaggatgtcttcagagggagcgtcttggaaggggtgctacct
ggcacttccgtgatgcaggtgacagccacggatgaggacgacgccgttaacacctacaac
ggtgtggttgcttactccatccacagtcaagagccaaaggacccgaatgacctcatgttc
acagtccaccggagcacgggtaccatcagcgtcatctccagtggcctggaccgggaaaga
gtccccgagtacacactgaccatccatgccacagacatggatggggacggctccagcacc
acggctatggccatagtggaaatcctcgatgccaacgacaatgctcccgtgtttgatccc
cagaagtatgaggcccgtgtgcctgagaacacagtgagccacgaggtgcagaggctgaca
gtgactgatctggacgcccctaactcaccagcatggcgtgccacctaccgcatcgtggga
ggtgacaacggggaccattttaccatcactactgaccccgagagcaaccagggtatcctg
accacccagaagggcttggattttgaggccaaaacccagcacaccctgtacgtcgaagtg
atcaacgaggttccctttgtggtgaaactcccgacctccacagccaccgtagtggtcctc
gtggaggatgtgaatgagccacccgtgtttgtccccccgtccaaagtcatcgaaatccag
gagggcatctccactggggagcctatttgtgcctacactgcacgggacccagacaagggg
agtcagaagatcagttaccacatcctgagagacccagcagggtggctagcgatggaccca
gacagtggacaagtcactgccgcaggggtcttggaccgtgaggatgagcagtttgtgaga
aacaacatctacgaagtcatggtcttggccacagatgatggagacgcagtagccttgtcc
ctgaagaagttcctaaagcaaggcgaatacgatgtgcacctttccctgtccgaccacggc
aacaaggaacagctgacagtgatcagagccaccgtgtgtgactgccacggcaacatggtg
acctgccgggacccctggacgtggggtttcctcctccccatcctgggtgctgccctggct
ctgctgctccttctgctggtgctcctattcttggtgagaaagaaacggaagatcaaggaa
ccccttctcctcccagaagatgatacccgtgacaacgtcttctactacggcgaagagggg
ggtggcgaggaggaccaggactatgacatcacccagctccaccggggtctggaggcccgg
cctgaggtggttctccgcaacgatgtggcaccatccttcatccccacacccatgtaccgt
cctcggccagccaacccagatgaaatcggcaacttcatcattgagaacctgaaggcagcc
aacacagaccccacggccccgccctacgactccctgttggtgttcgactatgagggcagt
ggctccgatgccgcctctctgagctcgctcacctcctcaacctctgaccaggaccaagac
tacaactatctgaatgagtggggcagccgcttcaagaagctggcggacatgtacggcggg
ggccaggacgactag

DBGET integrated database retrieval system