KEGG   Bos indicus (zebu cattle): 109572641
Entry
109572641         CDS       T04792                                 

Gene name
NECTIN2
Definition
(RefSeq) nectin-2 isoform X1
  KO
K06531  poliovirus receptor-related protein 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04520  Adherens junction
biu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109572641 (NECTIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109572641 (NECTIN2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109572641 (NECTIN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109572641 (NECTIN2)
   04090 CD molecules [BR:biu04090]
    109572641 (NECTIN2)
Cell adhesion molecules [BR:biu04515]
 Immunoglobulin superfamily
  Nectin family
   109572641 (NECTIN2)
CD molecules [BR:biu04090]
 Proteins
  109572641 (NECTIN2)
SSDB
Motif
Pfam: C2-set_2 Ig_3 ig V-set Ig_2 I-set
Other DBs
NCBI-GeneID: 109572641
NCBI-ProteinID: XP_019835157
Position
18
AA seq 539 aa
MARDAALRPLRLSPPTLPLLPLLLLLLRETGAQDVRVQVAAEVRGNLGDTVELPCHLLPS
APEIRVSQVTWLRLDAPEGKQNVAIFHPQYGRSFPSPKPGKERLSFVNTAPSSGAGQGSE
LEVRDATLSLRGLTVEDEGNYTCEFATFPKGTSRGVTWLRVIAQPQNHAEKQEVTFNLDP
VPVARCVSAGGRPPARVSWLSPLDGEAKETQGSGPLPGTVTVTSRYTVTPLSEADGVKVI
CKVEHESFQEPKLLPVILSVRYPPQVSISGYDDNWYIGRSEATLNCNVRSKPEPTGYDWS
TTSGVFPASAVAQGPKLIVHSVDRLFNTTFICTVTNAVGTGQAEQVVLVRETPNTAGAGA
TGGIIGGIIAAIIATAVAATGILICRQQRKEQRLQGAEEEEELEGPPSYKPPTPKAKLEE
PEMPSQLFTLGASEHSPLKTPYFDAGVSCAEQEMPRYHELPTLEERSGPLILGATSLGSP
ILVPPGPPAVERVSLDLEDEEEEEDYMDKINPIYDALSYSGPPESYQGKGFVMSRAMYV
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggcccgggacgcagccctccggccgttgagattgtcgccgccgacgctgcctctactg
ccgttgctgctgctcctgctccgggaaaccggagcccaggatgtgcgagttcaggtcgcc
gctgaggtgcggggcaacctgggggacacggtagagctgccgtgccacctgctgccttca
gcgcctgaaatccgagtgtcccaggtgacgtggctgcgcctggacgcgcccgaaggcaaa
cagaacgtggccatcttccacccccagtatggtcgcagcttccccagcccgaagcccggc
aaggagcggctgtccttcgtcaataccgcgccgagctcgggggccgggcaaggctcggag
ctggaggtgcgggacgccacgctgtccctccgggggctgacggtggaggacgagggcaac
tacacttgcgagtttgccacctttcccaagggcaccagtcggggagtcacctggctcaga
gtcatagcccagccccagaaccatgccgagaaacaggaggtcacattcaatttggatcct
gtacccgtggcccgctgtgtctccgcgggtggccgaccacctgcccgggtctcctggctc
tcacccttggacggggaggccaaagagacccaggggtcggggcccctgcctggcacggtc
accgtcactagccgctacactgtgacacccttgagcgaagcagacggtgtcaaggtcatc
tgcaaagtggaacatgagagcttccaggagcccaaactgctgccagtgattctctctgtg
cgctaccccccccaggtctccatatccggctatgatgacaactggtacatcggccgtagt
gaggccaccctgaactgtaacgtccgcagcaaaccrgagcccacgggctacgactggagc
acgacttccggtgtcttcccagcctcagcagtggcccagggccccaagctgatcgtccac
tcagtggaccggctgttcaacaccaccttcatctgcaccgtcaccaatgccgtgggcacc
ggccaagccgagcaggtggtcctcgttcgagagacacccaacacagccggagcaggggcc
acagggggcatcattgggggcatcatcgctgccatcatcgctactgctgtggccgccacg
ggcatcctgatctgcaggcagcagcggaaggagcagaggctgcagggggcagaggaggag
gaggaactggagggacctccctcatacaagccaccgaccccaaaggcaaagctggaggaa
ccagagatgccctcccagctcttcaccctgggggcctcggagcacagcccactcaagacc
ccctactttgatgctggtgtctcatgtgctgagcaggaaatgcctcgataccatgagctt
cccaccttggaagagcggtcagggcccctgatccttggggccacaagcctggggtccccc
atcctggtgcccccagggccacctgctgtggagagrgtctccctggatctagaggacgag
gaggaggaggaagactatatggacaagatcaaccccatctacgatgccctgtcctactcc
ggcccccctgagtcctaccagggcaaaggctttgtcatgtcccgggccatgtatgtgtga

DBGET integrated database retrieval system