KEGG   Bos indicus (zebu cattle): 109572759
Entry
109572759         CDS       T04792                                 

Gene name
PVR
Definition
(RefSeq) poliovirus receptor
  KO
K06539  poliovirus receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109572759 (PVR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109572759 (PVR)
   04090 CD molecules [BR:biu04090]
    109572759 (PVR)
Cell adhesion molecules [BR:biu04515]
 Immunoglobulin superfamily
  Necl family
   109572759 (PVR)
CD molecules [BR:biu04090]
 Proteins
  109572759 (PVR)
SSDB
Motif
Pfam: C2-set_2 V-set ig Ig_3 Ig_2 I-set C1-set TMEM154 Polysacc_synt FixQ DUF2207 Adeno_E3_CR2 Stevor Syndecan Cadherin_C_2 PRCH DUF3377 UPF0560 Orf78 EphA2_TM Hanta_G2
Other DBs
NCBI-GeneID: 109572759
NCBI-ProteinID: XP_019835390
Position
18
AA seq 405 aa
MAPAFVFTRRLLLQFLLFLFWTTLGAGTKIITVLAPVQVSGFLGENVTLPCKLHPLEHNV
TVTQVTWTKQRQAEPARSVAVFHPTQGPSFHESSRLEFMAAKPGEKLQDASLAVRELRVE
DEANYTCQFATFPNGDKSARTQLRVLAQPQNKVETLDIPLSPNPVPVARCVSTGGHPPAR
ISWSSDEKXNTTQVPGPLPGTVTVISLLILTPSSQVDGRNITCRVEHESLEEPMVLPMTL
AVSYPPEVSISGYDDNWYIGRREVALNCDIHSKPEPTGYNWSTPNGTLPVSAVVQGTQLL
IHTVDETINVTFICLVTNALGTNQANVTILVRERPREKSQEGSTIYIILALVILILFVVF
LVFLLIYLCRRKNSRRNQYSPTANGTVIYSAVASNSQDPSTEGTR
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggcccctgcgtttgtcttcactcggcggctgctgctgcagttcctgctgtttttgttc
tggacgaccctgggagccgggaccaagataatcacagtgctggccccagtccaggtgtcc
ggtttcctgggagaaaatgtgacactgccatgcaaactgcaccccctggaacacaacgtg
acggtgacgcaagtgacctggacaaagcagagacaggcagagcccgcccgcagcgtggcg
gtcttccaccccacccagggccccagcttccacgagtccagccggttggaatttatggcc
gccaagcccggagagaagctgcaggatgcctcactggctgtgcgggagttgcgcgtggaa
gatgaggctaattacacctgccagttcgctaccttccctaatggtgacaagagcgctcga
acccagctccgtgtgctcgcccagccccagaacaaggttgagaccctggacatcccgctc
agcccgaaccctgtgccggtggctcgctgtgtctccaccggaggtcacccacctgcccgc
atctcctggtcctcagatgaaaagrccaataccacccaggtgccagggcctctgcctggc
accgtcaccgtcatcagcctcttaatcttaacaccgtccagccaggtggacggcaggaac
atcacctgcagagtggagcacgagagcttggaggagcccatggtgctccccatgaccctg
gctgtgtcctacccccccgaggtctccatatccggctatgatgacaactggtacatcggc
cgtagagaggttgccctgaactgtgacatccacagcaaaccagagcccacgggctacaac
tggagcacgcccaacggaaccctgccagtctctgctgtggtccagggcactcagctcctg
attcatactgtggacgagaccatcaatgtgactttcatctgccttgtcaccaacgcccta
gggaccaaccaggcaaacgtgaccatcctggtcagagaacgtcctagggaaaagtcacaa
gagggctctacgatctatatcatcctggccttggtaatcctratcctgtttgttgtcttc
ctggtgttcctcctgatttatctctgccggcgcaaaaactcccgtcggaaccagtacagt
cccactgctaatgggacggtcatctattcagctgttgcgagcaattcccaggatccatca
acagagggcaccaggtga

DBGET integrated database retrieval system