KEGG   Bos indicus (zebu cattle): 109572856
Entry
109572856         CDS       T04792                                 

Definition
(RefSeq) cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04015  Rap1 signaling pathway
biu04371  Apelin signaling pathway
biu04390  Hippo signaling pathway
biu04514  Cell adhesion molecules
biu04520  Adherens junction
biu05100  Bacterial invasion of epithelial cells
biu05200  Pathways in cancer
biu05213  Endometrial cancer
biu05216  Thyroid cancer
biu05218  Melanoma
biu05219  Bladder cancer
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109572856
   04390 Hippo signaling pathway
    109572856
   04371 Apelin signaling pathway
    109572856
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109572856
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109572856
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109572856
  09162 Cancer: specific types
   05226 Gastric cancer
    109572856
   05216 Thyroid cancer
    109572856
   05218 Melanoma
    109572856
   05219 Bladder cancer
    109572856
   05213 Endometrial cancer
    109572856
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    109572856
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:biu03036]
    109572856
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109572856
   04090 CD molecules [BR:biu04090]
    109572856
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    109572856
Cell adhesion molecules [BR:biu04515]
 Cadherins
  Major cadherins
   109572856
CD molecules [BR:biu04090]
 Proteins
  109572856
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro RET_CLD1 Cadherin_2 Cadherin_3
Other DBs
NCBI-GeneID: 109572856
NCBI-ProteinID: XP_019835550
Position
18
AA seq 883 aa
MGPRCRNLSALLLLLQVSSWLCQEPEPCIPGFGAESYTFTVPRRNLERGRVLGRVSFEGC
AGLPRTVYVSDDTRFKVHTDGVLTVRRPVHLHRPELSFLVHAWDSTHRKLSTKVTLEVSA
HHHHHHSHHDSPSGTQTEVLTFPGPHHGLRRQKRDWVIPPISCPENEKGPFPKSLVQIKS
NKEKETQVFYSITGQGADTPPVGVFIIERETGWLKVTQPLDREQIAKYILFSHAVSSNGQ
AIEEPMEIVITVTDQNDNKPQFTQEVFKGSVLEGALPGTSVMQVTATDIDDEVNTYNAAI
GYKILAQDPMLPHNKMFTINKETGVISVLTTGLDRESFPTYTLMVQAADLNGEGLSTTAT
AVITVLDTNDNAPRFNPTTYVGSVPENEANVAITTLTVTDADDPNTPAWEAVYTVLNDNE
KQFIVVTDPVTNEGTLKTAKGLDFEAKQQYILYVAVTNVAPFEVTLPTSTATVTVDVIDV
NEAPIFVPPQKRVEVPEDFGVGLEITSYTAREPDTFMEQKITYRIWRDTANWLEINPETG
AISTRAELDREDVDHVKNSTYTALIIATDNGSPPATGTGTLLLFLDDVNDNGPVPEPRTM
DFCQRNPEPHIININDPDLPPNTSPFTAELTHGASVNWTIEYNDQERESLILKPKKTLEL
GDHKINLKLIDNQNKDQVTTLDVHVCDCDGIVSNCRKATXFAEAGLQVPAILGILGGILA
FLILILLLLLLVRRRRVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDAR
PEVTRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSG
SEAATLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgggccctcggtgccgcaacctctctgcgctcctgctgctgctgcaggtgtcatcgtgg
ctctgccaggagccggagccctgcattcctggctttggtgctgagagttacacgttcacc
gtgccccggcggaacttggagagagggcgagtcctaggcagagtgagttttgaaggatgt
gctggcctaccaaggacagtctatgtttctgatgacacccgattcaaagtgcacacagat
ggcgtgcttacagtcagacgacctgtacaccttcatcgtccagagctaagttttcttgtc
catgcctgggactccacccacaggaagctctccaccaaagtgacactggaggtatcagcg
caccaccaccaccaccacagtcatcatgactctccctctggaacccagacggaagtgctc
acatttcctggyccccaccatggtctcaggagacagaagagagactgggttattcctcct
atcagctgcccagaaaatgagaaaggcccrtttcctaagtcgctggtccagatcaaatct
aacaaggagaaagaaacccaagttttctacagcatcactggccaaggagctgatacaccc
cctgtcggtgtttttattattgaaagagaaacaggatggttaaaagtgacacagcctctg
gatagagaacagattgccaagtacattctcttctctcatgccgtgtcttcaaacggacaa
gccattgaagagcctatggagattgtgatcaccgtgaccgaccagaatgacaacaagccc
cagttcacccaggaggtcttcaaggggtctgtcctggaaggcgctcttccaggaacctct
gtgatgcaggtcacggccacagatatagatgacgaggtgaacacctacaacgctgccatc
ggttacaaaatcctagcccaagatcccatgctgccgcacaacaaaatgttcaccatcaac
aaggaaacaggcgtcatcagtgtgctcaccaccgggctggaccgtgagagttttcccaca
tacaccctgatggtccaagcagcagaccttaacggcgaaggcttgagcacaactgcaacg
gccgtgatcacagtcttggacaccaatgataatgctcccagattcaacccaaccacgtay
gtggggtcrgtgcctgagaacgaggctaatgtggccatcaccacactcacagtgactgat
gccgacgaccccaacaccccggcatgggaggctgtttacacagtattaaatgataacgag
aagcaatttatcgtcgtcacagacccagtcaccaatgaaggcactctgaaaacagctaag
ggcttggattttgaggccaagcagcagtacatcctgtacgtggcagtgacaaatgtggcc
ccctttgaagtcactctccccacttccacagccaccgtcactgtggatgtgatagatgtg
aatgaagcccccatctttgtgcctcctcaaaagagagtggaagtgcccgaggactttggc
gtgggcctggagatcacatcctatactgcccgggagccagacacatttatggaacagaag
atcacgtatcggatttggagggacactgccaactggctggagattaatccagaaacgggt
gccatttccactcgggctgagttggacagagaggatgtcgatcatgtgaagaacagcacg
tacacggccctcattatagccactgacaatggttctccacctgccactgggacaggcacc
ctgctcttgttcctcgatgatgtgaatgacaatggccccgtaccagaaccccggaccatg
gacttctgccagaggaatcctgagcctcacatcatcaacatcaatgatcctgatctccct
ccgaacacctccccctttacagcagaactgacacatggggcgagtgtcaattggaccatt
gagtacaatgaccaagaacgtgagtctctgattttgaagccaaagaaaaccttagagctg
ggtgaccacaaaatcaatctcaagctcatagacaaccagaacaaagaccaggtgaccaca
cttgatgtgcacgtgtgtgactgtgatgggatcgtcagcaactgcaggaaggccacggyc
tttgctgaagcaggattrcaagttcccgccatcctggggatcctcggaggcatccttgct
tttctgatccttattttgctgcttctgctacttgttcggaggagaagggtggtmaaagag
cccttactgcccccagaagatgacacccgggacaatgtgtattactatgatgaagaagga
ggtggagaagaagatcaggactttgacttgagccagttacataggggcctggatgctcgg
cctgaagtgactcgcaatgacgtggcaccaaccctcatgagtgtgccccagtaccgaccc
cgccctgccaatcctgatgaaattggaaactttattgatgaaaacctgaaggcagctgat
agtgaccccactgccccaccctatgactctctgctggtgtttgattatgaaggaagtggt
tccgaagctgctactctgagctccctgaactcctcagagtcagaccaagaccaggactat
gactacctgaatgaatggggcaatcgcttcaagaagctggcggacatgtatggaggcggc
gaggatgactaa

DBGET integrated database retrieval system