KEGG   Bos indicus (zebu cattle): 109572958
Entry
109572958         CDS       T04792                                 

Gene name
C5AR1
Definition
(RefSeq) C5a anaphylatoxin chemotactic receptor 1
  KO
K04010  C5a anaphylatoxin chemotactic receptor 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04080  Neuroactive ligand-receptor interaction
biu04610  Complement and coagulation cascades
biu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109572958 (C5AR1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109572958 (C5AR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109572958 (C5AR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109572958 (C5AR1)
   04090 CD molecules [BR:biu04090]
    109572958 (C5AR1)
G protein-coupled receptors [BR:biu04030]
 Rhodopsin family
  Peptide
   Anaphylatoxin
    109572958 (C5AR1)
CD molecules [BR:biu04090]
 Proteins
  109572958 (C5AR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srv FA_desaturase 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 109572958
NCBI-ProteinID: XP_019835694
Position
18
AA seq 352 aa
MDSMALSTPDYSXYDKWTSNPDVLVDASSXTHRLRVPDVIALVIFAAVFLIGVPGNAMVV
WVTGSEVKRTVNAIWFLNLAVADFLSCLALPILFTSIIQHNHWSFGDAACRILPSLILLN
MYASILLLATISADRFLLVFNPVWCQNYRGARVAWVACAVAWGLALLLTIPSFVFRQVHI
DHFPPKTXCVVAYGKDREYAEKAVAIVRLAVGFLGPLVTLXICYTFLLLRAWSRTATRSA
KTLKVVVAVVTSFFVFWLPYQVTGMMLAFFNVHGDSFKLVSSLDALCVSLAYINCCINPI
IYVFAAQGFHARFLKTLPARLRGVLTEESVRRESKSQTLSTADTPAVKSQAV
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggactccatggctctcagcacccctgactactctgrttatgataaatggacctcgaac
cccgatgtcttggtggatgcctcttcccycacccacagactgcgtgtcccagatgtgatc
gccctggtgatcttcgcggccgtcttcctgatcggggtgcccggcaacgccatggtggtc
tgggtgacagggtccgaggtcaagcggaccgtcaacgccatctggtttctcaacctagcg
gtggccgacttcctctcctgcctggcactgcccatcttgtttacatccatcatccagcac
aaccactggtcctttggtgatgctgcatgtcgaatcctgccctctctcatccttctcaac
atgtaygccagcatcttgctcctggccaccatcagcgccgaccgcttcctgctggtgttc
aatcccgtctggtgccagaactaccgaggggcccgcgtggcctgggtggcctgtgccgtg
gcctggggcttggctctgctgctgaccataccgtcctttgtgttccgtcaggtccacata
gaccacttcccacccaagacgaygtgtgtcgtcgcatacggtaaggaccgtgaatatgcg
gagaaggccgtggccatcgtccggctggccgtgggcttcctggggccgctggtcacgctt
rcaatctgttacaccttcctcctgcttcgggcatggagccgcactgccacgcgctccgcc
aagacgctcaaggtggtggtggccgtggtgaccagcttctttgtcttctggctgccctac
caggtgacggggatgatgctggcctttttcaatgtgcacggggacagcttcaaactcgtg
tccagtctagatgccctgtgcgtctccctagcttatatcaactgctgcattaaccccatc
atttacgtgttcgccgcccagggctttcacgcccggttcctgaagaccctccccgccagg
ctccggggcgtgttgactgaagagtcggtgcgcagggagagcaagtcccagacgctctcc
acggcggataccccggccgtgaagagccaggcagtgtaa

DBGET integrated database retrieval system