KEGG   Bos indicus (zebu cattle): 109572985Help
Entry
109572985         CDS       T04792                                 

Gene name
CPT1C
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, brain isoform
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00071  Fatty acid degradation
biu01212  Fatty acid metabolism
biu03320  PPAR signaling pathway
biu04152  AMPK signaling pathway
biu04714  Thermogenesis
biu04920  Adipocytokine signaling pathway
biu04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109572985 (CPT1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    109572985 (CPT1C)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    109572985 (CPT1C)
   04920 Adipocytokine signaling pathway
    109572985 (CPT1C)
   03320 PPAR signaling pathway
    109572985 (CPT1C)
  09159 Environmental adaptation
   04714 Thermogenesis
    109572985 (CPT1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:biu03029]
    109572985 (CPT1C)
Enzymes [BR:biu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     109572985 (CPT1C)
Mitochondrial biogenesis [BR:biu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    109572985 (CPT1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 109572985
NCBI-ProteinID: XP_019835734
Position
18
AA seq 779 aa AA seqDB search
MAEAHQAVGFRPSLTSDAGEVELGVPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPL
SWLFLFSAIQLACFLQLDPSLGLMEKIKESLPDWGGQHHRLRGVLAAALFASCLWGALIF
TLHVALRLLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQ
DTVRKYLESVRPVLSDKDFDWTAGLAQEFLKLQASLLQWYLQLKSWWASNYVSDWWEEFV
YLRSRNSLMVNSNYYMMDFLYVTPTPVQAARAGNAVHALLLYRHHLDRQEILPTLLMGMR
PLCSAQYEKIFNTTRIPGVHRDHIRHLRDSRHVAVFHRGRFFRVGTHSQSRLLSPRALEQ
QFQRILDDPSPACPHEEHLAALTAAPRDTWAQVRRSLKTQAQEALEAVEGAAFFVSLDSE
PAGLTREDPAASLDAYAHALLAGQGHDRWFDKSFSLIVFSNGKLGLSVEHSWADCPISGH
MWEFTLATECFQLGYSADGHCKGHPDPLLPQPQRLHWDLPDKIHLSISLALRAAKTLSGN
IDCHVFPFSHFGKNFIKRCHLSSDSFIQTTLQLAHFRDRGQFCLTYESTMTRLFLEGRTE
TVRSCTREARDFVRAMEDKEKTDAQCLALFRLAVDKHQALLKAAMSGQGVDRHLFALYXV
SQFLHLQSPFLDQVHSEQWQLATSQIPVQQIHLFDVHNYPDYVSSGGGFGPADDHGYGVS
YMFMGDDVITFHISSKKSSTRTDSHRLGQRIQDALLDVAALFPEGQXLKRRGLGEEDSG
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagctcaccaggcggtgggcttccgaccctcactgacttcggacgcgggggaa
gtggagctcggtgtcccggtgttacaggagatctacctctccggactgcgctcttggaaa
aggcatctctcccgtttctggaacgactttctcacaggtgtgttccctgctagccccctc
agctggcttttcctcttcagtgcaattcaacttgcctgcttcctccagctggatccttcc
ttaggactgatggagaagatcaaagagtctctgccagactggggtggacagcatcacagg
ctgcggggggtcctggcggccgcgctgtttgcgtcctgtctgtggggagctctgatcttc
acgcttcatgtggccctgaggctacttctgtcctaccacggctggctcctcgaaccccac
ggagccatgtcctcgccaaccaagacctggctggccctggtgcgcatcttctccggccgc
catccaatgctcttcagttaccagcgctctcttccgcgtcagcctgtgccctccgttcag
gacactgtgcgcaagtatctggagtctgtccgacccgtcctctccgacaaggacttcgac
tggaccgcgggcctagcgcaggaattcctgaagctgcaggcctcactgctgcagtggtac
ttgcagctcaagtcctggtgggcgtccaattacgtcagtgactggtgggaagaattcgtg
tacctgcgctccaggaactcactgatggtgaacagcaactattacatgatggacttcctg
tacgtcacgcccactcctgtgcaggcggcgcgcgcgggcaacgcagtccacgccctcctt
ctgtaccgccaccacctggaccgccaggagatcctgccaactttgctgatgggaatgcga
cccttgtgctccgcccagtatgagaagatattcaacaccackcgaattcccggggtccac
agagatcacatccgccacctccgtgacagccgacacgtggccgtcttccaccggggccgg
ttcttccgcgtggggacccactcgcaaagccgcctgctttccccgcgggccctggagcag
cagtttcaacgaatcctggacgacccctctcccgcctgcccccacgaggagcatctggcg
gccttgaccgctgctccgagggacacctgggcccaggtgcggaggtctctgaagacccag
gcccaggaggccctggaagctgtcgaaggggccgctttcttcgtatccctcgactcagag
cccgcggggctcaccagggaggaccccgcagcttccttagacgcctacgcacatgccctg
ctggctggccagggccacgaccgctggtttgacaaatccttctccctaatcgtcttctcc
aatgggaagctgggcctcagcgtggagcactcatgggctgactgccccatctcaggacac
atgtgggagttcactctggccacagaatgctttcagctgggctactcggcagacggtcac
tgcaaggggcaccctgacccyttgctgccccagccccagaggctgcactgggaccttcca
gacaagatccatctatccatctctctagccctgagggcagccaagaccttgtctggaaac
atcgactgccacgtcttccccttctcccactttggcaagaatttcatcaaacgctgccat
ctctcttcagacagcttcatccagaccaccttgcagctggcccacttccgggacaggggt
cagttctgcctgacttatgaatccaccatgactcgcttgttcctggaaggccgcacagag
acggtgcgttcttgcacgagggaggcccgcgactttgtgagagccatggaggacaaagag
aagacagacgcacagtgcctcgccctgttccgcctggcggtggataagcaccaagctctg
ctgaaggcagcgatgagtggacagggggtcgatcgccacctctttgctctctacrtcgtg
tcccagttcctccacctgcagtctccattcctggaccaggttcactcagagcagtggcag
ctggccaccagccagattcctgttcagcaaattcacctgttcgacgttcataattacccc
gactatgtctcctctggtggtggattcgggcctgccgatgaccatggttacggtgtgtcc
tacatgttcatgggcgatgacgtgatcaccttccacatctcgagcaaaaaatcaagcaca
agaacggactcccaccggctgggccagcgcatccaggacgccttgttggacgtggccgcc
ctcttcccggaggggcagcrtcttaagcgcagagggttaggggaggaagactcgggttag

DBGET integrated database retrieval system