KEGG   Bos indicus (zebu cattle): 109572989
Entry
109572989         CDS       T04792                                 

Gene name
PLAUR
Definition
(RefSeq) urokinase plasminogen activator surface receptor isoform X1
  KO
K03985  plasminogen activator, urokinase receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109572989 (PLAUR)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109572989 (PLAUR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109572989 (PLAUR)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109572989 (PLAUR)
CD molecules [BR:biu04090]
 Proteins
  109572989 (PLAUR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Receptors
  109572989 (PLAUR)
SSDB
Motif
Pfam: UPAR_LY6
Other DBs
NCBI-GeneID: 109572989
NCBI-ProteinID: XP_019835737
Position
18
AA seq 351 aa
MGGVGSSRXYAWREKVGKRLGKGGEPVGVSXGSSRHEGSWGLRCLQCENTTSCSVEECTP
GQDLCRTTVLSVWEGGNEMNVVRKGCTHPDKTNRSMSYRAADQIITLSETVCRSDLCNKP
NPGRDATVSRNRYLECASCSSTDLSCERGWDQTMQCLKSRDQCVDVITHRSLKENPGDER
HIRGCGILPGCPGPTGFHNNHTFHFLRCCNTTKCNAGSVLELQNLPPNGLQCYSCEGNGA
HRCSSEETFLIDCRGPMNQCLEATGTKGLRNPSYTIRGCAAPSWCQSLHVAEAFDLTHVN
VSCCTGSGCNHPARDDQPGKGGAPKTSPAHLSFFVSLLLTARLWGATLLCT
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcggagttggaagttctcggayttatgcgtggcgggagaaagttgggaagaggtta
ggaaagggaggagaacctgtgggcgttagttgrgggagctccaggcacgaaggctcttgg
ggcctgcggtgcttacagtgtgagaacacgacgagctgcagtgttgaagagtgtactcct
ggtcaggacctctgcaggaccacggtcctgagtgtgtgggaaggtggcaatgagatgaac
gtggtgagaaaaggctgtacccatccggacaagaccaacaggtccatgagctatcgggct
gcygatcagatcatcaccctttcagagaccgtgtgcaggtcagacttgtgcaacaagccc
aaccctggccgagatgctactgtttccagaaaccgctacctcgaatgtgcttcctgttcc
tcgacagacctcagctgtgagaggggctgggaccagaccatgcaatgcctcaaatctaga
gatcagtgcgtggatgtgataacccaccggagcctgaaagagaatccaggcgatgagcgc
cacatcagaggctgtggcatccttcctggctgcccaggccccaccggattccacaacaac
cacaccttccacttcctgcggtgctgcaacaccaccaaatgcaatgcaggctcagtcctg
gagcttcaaaacctgccaccaaacggcttgcagtgttacagctgtgaggggaacggcgcc
cacaggtgttcctctgaagaaactttcctcattgactgccgcggccctatgaatcaatgt
ctggaagcaacaggcactaaaggactgaggaacccaagctacaccatcagaggctgcgca
gccccctcgtggtgccaaagcctccacgtggctgaagccttcgacctcacccacgtcaac
gtctcctgctgtactggaagtggctgtaaccatccagccagggatgaccagcctggcaag
gggggtgcccccaagaccagccctgcccacctcagcttctttgtcagcctgctcttgact
gccagactttggggagccactctcctctgcacttga

DBGET integrated database retrieval system