KEGG   Bos indicus (zebu cattle): 109572993Help
Entry
109572993         CDS       T04792                                 

Gene name
HSD17B2
Definition
(RefSeq) estradiol 17-beta-dehydrogenase 2
  KO
K13368  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.239]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00140  Steroid hormone biosynthesis
biu01100  Metabolic pathways
biu04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    109572993 (HSD17B2)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    109572993 (HSD17B2)
Enzymes [BR:biu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     109572993 (HSD17B2)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     109572993 (HSD17B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 109572993
NCBI-ProteinID: XP_019835747
Position
18
AA seq 388 aa AA seqDB search
MGTFFSEPGWLFLTVTAVLGGTILCKLKTSPGQVGRKVVCLAGLWGGACLISLSLFWGLV
LFSLSYFVMYTYFSGQELLPVDQKAVLITGCDSGFGHGLAKYLDELGFTVFAGVLDEQGS
GAEELRRTCSKNLSVLQLNITNTQEIKAAYSKVKEKLQNKGLWAVINNAGVLGLPTDGEL
IPMTEYKRCMAVNFFGAVEVTKVFLPLLRKSKGRLVNISSMAGGVPMQKMAAYGSSKAAL
IMFSSILRQELSKWGVKVSVIQPGGFKTNISGTSQMWEKLERTVLDNLSPEVQEDYGQDY
ILSERSFLNLMKTSTDPDISPVLLDVRHAISAQSPFAFYAPGKLSYPWLCFASVSPTGIF
DYLSRKIHTYSKKMPRVLSTSNWENEAM
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgggcactttcttctctgagcctgggtggctcttcctgactgtcaccgcagtgctggga
ggaacaattctttgcaaactcaagactagcccagggcaggtggggagaaaggtggtctgc
ctggcgggcctctggggaggcgcttgcctgatcagcctgtccctcttctggggcttggtc
ctcttctccctgtcgtatttcgtcatgtatacttacttttctggccaagagttrttacct
gtggatcaaaaggcggtgctgataacaggttgtgattctgggtttggccatggtttggcc
aagtatctggacgagctgggcttcactgtatttgccggagttctggatgaacaggggtct
ggagcagaggaattacgaagaacctgctccaagaatctctctgtgctccagctgaacatc
accaacacgcaggagataaaagcggcctacagcaaagtgaaggagaagctgcagaacaaa
ggactgtgggctgtgatcaacaacgctggagtccttggcttaccaaccgatggggaactc
attcccatgaccgaatacaaacgatgcatggccgtgaacttcttcggggctgtggaagtc
acgaaggtgtttctgcctcttcttagaaaatccaaggggaggctggtgaatatcagcagc
atggcaggaggggttccaatgcagaagatggcagcctatggctcatccaaggcagctctg
atcatgttttcatcaatcctgcgacaagagctgtccaaatggggagttaaagtctctgtc
atccagcccggaggcttcaaaacaaacatctcaggcacgagtcaaatgtgggagaagctg
gagaggactgtcctggacaacctttcccctgaagtgcaagaggactacggccaggactat
atccttagcgaacgtagttttctcaacttaatgaaaacctccactgatccagacatctcc
ccagtgctcctggacgttcggcacgccatctctgctcagagcccctttgcattttatgcg
ccggggaaattgtcttatccgtggctctgttttgcttccgtcagccctactggcatattt
gattatcttagcagaaaaatacatacctacagtaagaagatgcccagagtgttaagcaca
tctaactgggagaatgaggctatgtag

DBGET integrated database retrieval system