KEGG   Bos indicus (zebu cattle): 109573310
Entry
109573310         CDS       T04792                                 

Definition
(RefSeq) contactin-associated protein 1-like
  KO
K07379  contactin associated protein 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109573310
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 F5_F8_type_C EGF DUF3919
Other DBs
NCBI-GeneID: 109573310
NCBI-ProteinID: XP_019836031
Position
19
AA seq 1114 aa
MMRLRLFCILLAAVSGARGWGYYGCDEELVGPLYARSLGASSYYGLFTAPRFARLHGISG
WSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHN
AVLQDPCTHTWEPSQLCDLGWAGHRFGGSGGGGGGEGTDEEQLLLRLGGLLGGSSPIQPR
PGHTTVSAGGVLNDQHWHYVRVDRFGREANLTLDGYVQRFVLNGDFERLNLDNEMFIGGL
VGAAQKNLAYRHNFRGCIENVIFNRVNIADLAVRRHSRITFEGKVAFRCLDPVPHPINFG
GPHNFVQVPGFPRRGRLAVSFRFRTWDLTGLLLFSSLGDGLGHVELMLSEGQVNVSVVQT
GRKKLQFAAGFRLNDGFWHEVNFVAQENHAVISIDDVEGAEVRVSYPLLIRTGTSYFFGG
CPKPASRSGCHSNQTAFHGCMELLKVDGQLVNLTLVEGRRLGYYAEVLFDTCGITDRCSP
NMCEHDGRCYQSWDDFICYCELTGYKGETCHQPLYKESCEAYRLSGKTSGNFTIDPDGSG
PLKPFVVYCDIRENRAWTVVRHDRLWTTRVTGSSMERPFLGAVQYWNASWEEVSALANAS
QHCEQWIEFSCYNSRLLNTAGGYPYSFWIGRNEEQHFYWGGSQPGIQRCACGLDRSCVDP
ALHCNCDADQPQWRTDKGLLTFVDHLPVTQVVVGDTNRSSSEAQFFLRPLRCYGDRNSWN
TISFHTGAALRFPPIRANHSLDVSFYFRTSAPSGVFLENMGGPYCQWRRPYVRVELNTSR
DVVFAFDVGNGDENLTVHSDDFEFNDDEWHLVRAEINVKQARLRVDHRPWVLRPMPLQTY
IWLEYDRPLYVGSAELKRRPFVGCLRAMRLNGVTLNLEGRANASEGTSPNCTGHCAHPRF
PCFHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFFEPGTWMRYNLQSALRSAAREFSH
MLSRPVPGYEPGYIPGYDTPGYVPGYHGPGYRLPDYPRPGRPVPGYRGPVYNVTGEEVSF
SFSTQSAPAVLLYVSSFVRDYMAVLIKEDGTLQLRYQLGTSPYVYQLTTRPVTDGQPHSV
NITRVYRNLFIQVCARGSDHNLIIKAVADLPMWD
NT seq 3345 nt   +upstreamnt  +downstreamnt
atgatgcgtctccggcttttctgcatcctactcgccgcggtctcaggagcccggggctgg
ggctactacggctgcgacgaggagctggtcgggcccctgtatgcacgctccctgggcgcc
tcctcctactatgggctcttcactgcgccccgatttgcccggctgcacggcataagcgga
tggtctccccggattggggacccaaatccctggctgcagatcgacctaatgaagaagcac
cggattcgggctgtggccacgcagggctcctttaactcgtgggactgggtcacacgttac
atgctgctctacggcgaccgagtggacagctggacaccgttctatcagcgagggcacaac
gcggtactccaggatccctgcacacacacttgggaaccttcccaactgtgtgacctgggc
tgggctgggcacaggtttgggggaagtggggggggaggtggtggtgagggcacagatgag
gagcagctgttgctccgcctggggggtttgctgggcggcagcagccccatccagccaagg
ccgggtcacacgaccgtgagcgctggcggcgtcctcaatgaccagcactggcattacgtg
cgtgtcgaccgatttggccgtgaggcaaatctcaccctggacggctacgtgcagcgcttc
gtgctcaatggcgacttcgagagactgaacctggacaacgagatgttcatcggggggctg
gtgggcgccgcgcagaagaaccttgcctatcggcataatttccgcggctgcatagaaaac
gtcatcttcaaccgagtcaacatcgcggacctggccgtgcggcgccattcccggatcacc
ttcgagggtaaggtggcattccgttgcctggacccggttcctcatcccatcaatttcgga
ggtcctcacaacttcgtgcaagtgcctggcttcccccgccgcggccgcctcgcagtctct
tttcgcttccgcacctgggatctcactgggctgctgcttttctcctccctgggggatggg
ttgggccacgtggagctgatgctcagtgaagggcaggtcaacgtgtcggtggtgcagacc
ggccgaaagaagcttcagtttgccgctgggttccgcctgaatgatggcttttggcatgag
gtgaattttgtggcccaggaaaaccatgcagtcatcagcattgatgatgtggagggggca
gaggtcagggtctcatacccactgctgatccgtacaggaacctcatacttctttggaggt
tgtcccaagccagccagtcgatcgggctgccactccaaccagacggcgttccatggctgc
atggagctgctcaaggtggatggtcaactggtcaacctgactctggtggagggccggcgg
cttggatactatgctgaggtcctctttgacacatgtggcatcactgataggtgcagccct
aacatgtgtgagcatgacggtcgctgctaccagtcttgggatgacttcatctgctactgt
gaactgacaggctacaagggggagacctgccaccagcctttgtataaggaatcctgtgag
gcttatcgactcagtgggaaaacttctggaaacttcaccattgatcctgatggtagtggc
cccctgaagccatttgtggtgtactgtgatatccgagagaatcgggcatggacagttgtg
cgccatgacaggctgtggacgactcgggtgacaggttccagcatggagcggccattcctc
ggggccgtccagtattggaatgcatcctgggaggaggtcagtgccctggccaatgcttcc
cagcactgtgagcagtggatcgagttctcctgctacaattcccggctgctcaacacagca
ggaggctacccctacagcttttggattggccgaaacgaggagcagcacttctactggggc
ggctcgcagcctgggatccagcgctgtgcctgtggtctggaccggagctgcgtggacccc
gctctgcactgtaactgtgacgccgaccagccccagtggagaaccgacaagggcctgctg
acctttgtggaccatctgcctgtcactcaggtggtggtgggggacacgaaccgctccagt
tcggaggcccagttctttctgaggcctctgcggtgctacggcgaccgaaattcctggaac
accatctccttccacactggggctgcactacgctttcccccaatccgggccaaccacagc
cttgacgtctctttctacttcaggacctcggctccctcaggagtcttcctagagaatatg
gggggcccttactgccagtggcgccgaccttatgtgcgggtggaactcaacacatcccgg
gacgtagtcttcgcctttgacgtggggaatggggatgagaacctgacggtgcactcagac
gacttcgagttcaacgacgatgagtggcacctcgtccgggcggaaatcaacgtgaagcag
gcccggctccgcgtggatcaccggccctgggtgctacggccgatgcccctgcagacctac
atctggctggagtacgaccggcccctgtatgttggatctgcagagcttaagaggcggcct
ttcgtgggttgcttgagggctatgcgtctgaatggagtgactctgaacctggaaggccgt
gccaatgcctctgagggtacctcacccaactgcacaggccactgcgcccacccccgcttc
ccctgtttccatggcggccgctgtgtggagcgctacagctactacacctgtgactgtgac
ctcacggctttcgatgggccatactgcaaccatgacattggcggtttctttgagcctggc
acctggatgcgctataacctccagtcggcgctgcgctccgcagcccgggagttctcccac
atgctgagccggccagtgccgggctacgagcctggttacatccctggctatgatactccc
ggctacgtgcctggctaccatggccctgggtaccgtctgcctgattacccgcggccaggc
cggccggtgccaggctaccgtggacctgtctacaacgtcactggagaggaggtgtccttc
agcttcagcacccagtctgcccccgccgtcctgctctatgtcagctcctttgtgcgtgac
tacatggccgtgctcattaaggaagatgggaccttgcagctgcgctaccagctgggcacc
agcccctatgtgtaccagctaaccacccgccctgtgacggacggccagccccacagtgtc
aacatcacccgggtctaccgcaacctcttcatccaggtgtgtgccaggggttcagatcat
aacctcatcatcaaggctgtggcagacttgcctatgtgggactga

KEGG   Bos indicus (zebu cattle): 109574304
Entry
109574304         CDS       T04792                                 

Definition
(RefSeq) contactin-associated protein 1
  KO
K07379  contactin associated protein 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109574304
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 EGF
Other DBs
NCBI-GeneID: 109574304
NCBI-ProteinID: XP_019837836
Position
19
AA seq 1088 aa
MFIGGLVGAAQKNLAYRHNFRGCIENVIFNRVNIADLAVRRHSRITFEGKVAFRCLDPVP
HPINFGGPHNFVQVPGFPRRGRLAVSFRFRTWDLTGLLLFSSLGDGLGHVELMLSEGQVN
VSVVQTGRKKLQFAAGFRLNDGFWHEVNFVAQENHAVISIDDVEGAEVRVSYPLLIRTGT
SYFFGGCPKPASRSGCHSNQTAFHGCMELLKVDGQLVNLTLVEGRRLGYYAEVLFDTCGI
TDRCSPNMCEHDGRCYQSWDDFICYCELTGYKGETCHQPLYKESCEAYRLSGKTSGNFTI
DPDGSGPLKPFVVYCDIRENRAWTVVRHDRLWTTRVTGSSMERPFLGAVQYWNASWEEVS
ALANASQHCEQWIEFSCYNSRLLNTAGGYPYSFWIGRNEEQHFYWGGSQPGIQRCACGLD
RSCVDPALHCNCDADQPQWRTDKGLLTFVDHLPVTQVVVGDTNRSSSEAQFFLRPLRCYG
DRNSWNTISFHTGAALRFPPIRANHSLDVSFYFRTSAPSGVFLENMGGPYCQWRRPYVRV
ELNTSRDVVFAFDVGNGDENLTVHSDDFEFNDDEWHLVRAEINVKQARLRVDHRPWVLRP
MPLQTYIWLEYDRPLYVGSAELKRRPFVGCLRAMRLNGVTLNLEGRANASEGTSPNCTGH
CAHPRFPCFHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFFEPGTWMRYNLQSALRSA
AREFSHMLSRPVPGYEPGYIPGYDTPGYVPGYHGPGYRLPDYPRPGRPVPGYRGPVYNVT
GEEVSFSFSTQSAPAVLLYVSSFVRDYMAVLIKEDGTLQLRYQLGTSPYVYQLTTRPVTD
GQPHSVNITRVYRNLFIQVDYFSLTEQKFSLLVDSQLDSPKALYLGRVMETGVIDPEIQR
YNTPGFSGCLSGVRFNNVAPLKTHFRTPRPMTXELAEALRVQGELSESNCGAMPRLVSEV
PPELDPWYLPPDFPYYHDDGWVAILLGFLVAFLLLGLVGMLVLFYLQNHRYKGSYHTNEP
KATHDYHAGSKPPLPTSGPVPAPAPASAPTPTPASTQVPAPAPAPAPAPAPGPRDQNLPQ
ILEESRSE
NT seq 3267 nt   +upstreamnt  +downstreamnt
atgttcatcggggggctggtgggcgccgcgcagaagaaccttgcctatcggcataatttc
cgcggctgcatagaaaacgtcatcttcaaccgagtcaacatcgcggacctggccgtgcgg
cgccattcccggatcaccttcgagggtaaggtggcattccgttgcctggacccggttcct
catcccatcaatttcggaggtcctcacaacttcgtgcaagtgcctggcttcccccgccgc
ggccgcctcgcagtctcttttcgcttccgcacctgggatctcactgggctgctgcttttc
tcctccctgggggatgggttgggccacgtggagctgatgctcagtgaagggcaggtcaac
gtgtcggtggtgcagaccggccgaaagaagcttcagtttgccgctgggttccgcctgaat
gatggcttttggcatgaggtgaattttgtggcccaggaaaaccatgcagtcatcagcatt
gatgatgtggagggggcagaggtcagggtctcatacccactgctgatccgtacaggaacc
tcatacttctttggaggttgtcccaagccagccagtcgatcgggctgccactccaaccag
acggcgttccatggctgcatggagctgctcaaggtggatggtcaactggtcaacctgact
ctggtggagggccggcggcttggatactatgctgaggtcctctttgacacatgtggcatc
actgataggtgcagccctaacatgtgtgagcatgacggtcgctgctaccagtcttgggat
gacttcatctgctactgtgaactgacaggctacaagggggagacctgccaccagcctttg
tataaggaatcctgtgaggcttatcgactcagtgggaaaacttctggaaacttcaccatt
gatcctgatggtagtggccccctgaagccatttgtggtgtactgtgatatccgagagaat
cgggcatggacagttgtgcgccatgacaggctgtggacgactcgggtgacaggttccagc
atggagcggccattcctcggggccgtccagtattggaatgcatcctgggaggaggtcagt
gccctggccaatgcttcccagcactgtgagcagtggatcgagttctcctgctacaattcc
cggctgctcaacacagcaggaggctacccctacagcttttggattggccgaaacgaggag
cagcacttctactggggcggctcgcagcctgggatccagcgctgtgcctgtggtctggac
cggagctgcgtggaccccgctctgcactgtaactgtgacgccgaccagccccagtggaga
accgacaagggcctgctgacctttgtggaccatctgcctgtcactcaggtggtggtgggg
gacacgaaccgctccagttcggaggcccagttctttctgaggcctctgcggtgctacggc
gaccgaaattcctggaacaccatctccttccacactggggctgcactacgctttccccca
atccgggccaaccacagccttgacgtctctttctacttcaggacctcggctccctcagga
gtcttcctagagaatatggggggcccttactgccagtggcgccgaccttatgtgcgggtg
gaactcaacacatcccgggacgtagtcttcgcctttgacgtggggaatggggatgagaac
ctgacggtgcactcagacgacttcgagttcaacgacgatgagtggcacctcgtccgggcg
gaaatcaacgtgaagcaggcccggctccgcgtggatcaccggccctgggtgctacggccg
atgcccctgcagacctacatctggctggagtacgaccggcccctgtatgttggatctgca
gagcttaagaggcggcctttcgtgggttgcttgagggctatgcgtctgaatggagtgact
ctgaacctggaaggccgtgccaatgcctctgagggtacctcacccaactgcacaggccac
tgcgcccacccccgcttcccctgtttccatggcggccgctgtgtggagcgctacagctac
tacacctgtgactgtgacctcacggctttcgatgggccatactgcaaccatgacattggc
ggtttctttgagcctggcacctggatgcgctataacctccagtcggcgctgcgctccgca
gcccgggagttctcccacatgctgagccggccagtgccgggctacgagcctggttacatc
cctggctatgatactcccggctatgtgcctggctaccatggccctgggtaccgtctgcct
gattacccgcggccaggccggccggtgccaggctaccgtggacctgtctacaacgtcact
ggagaggaggtgtccttcagcttcagcacccagtctgcccccgccgtcctgctctatgtc
agctcctttgtgcgtgactacatggccgtgctcattaaggaagatgggaccttgcagctg
cgctaccagctgggcaccagcccctatgtgtaccagctcaccacccgccctgtgacggac
ggccagccccacagtgtcaacatcacccgggtctaccgcaacctcttcatccaggtggac
tacttctccctgacggaacagaagttctcactgttggtggacagccagctagactcgccc
aaggccttgtatttggggcgcgttatggagactggagtgattgacccagagatccagcgc
tacaacacgccgggtttctcaggctgcctgtctggtgtccgattcaacaacgtggctcct
ctcaagacccacttccgaacgcctcgacccatgaccgmggagctggctgaggcccttcgt
gtccagggagagctgtctgagtctaactgcggagccatgccacgccttgtctcagaggtg
ccccctgagctggacccctggtatcttcccccagacttcccgtactaccatgatgacgga
tgggttgctatacttttgggctttttggtggccttcttgctgctgggactggtgggaatg
ttggtgctcttctatctacagaatcatcgctacaagggctcctaccacaccaatgagccc
aaggccacacatgattaccacgctggcagcaaacctcccctgcctacttcaggcccggtc
ccggccccagccccagcctcagccccgaccccaacaccagcttccacccaagttccagct
ccagccccagccccagccccagccccagcccctggcccccgggaccaaaacctaccccag
attctggaggagtccagatctgaatga

DBGET integrated database retrieval system