KEGG   Bos indicus (zebu cattle): 109573841
Entry
109573841         CDS       T04792                                 

Gene name
SERPINF2
Definition
(RefSeq) alpha-2-antiplasmin isoform X1
  KO
K03983  alpha-2-antiplasmin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109573841 (SERPINF2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109573841 (SERPINF2)
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I4: serpin family
   109573841 (SERPINF2)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 109573841
NCBI-ProteinID: XP_019836885
Position
19
AA seq 492 aa
MALLWGLLALILSCLSSLCSAQFSPVSTMEPLDLQLMDGQAQQKLPPLSLLKLDNQEPGG
QIAPKKAPEDCKLSPTPEQTRRLARAMMTFTTDLFSLVAQSSTRPNLILSPLSVALALSH
LALGAQNQTLQRLKEVLHADSGPCLPHLLSRLCQDLGPGAFRLAARMYLQKGFPIKEDFL
EQSEQLFGAKPMSLTGMKGEDLANINRWVKEATEGKIEDFLSDLPDDTVLLLLNAIHFQG
FWRSKFDPNLTQRGAFHLDEQFTVPVDMMQALTYPLHWFLLEQPEIQVAHFPFKNNMSFV
VLMPTRFEWNASQVLANLTWDILHQPSLSERPTKVQLPKLHLKYQLDLVATLSQLGLQEL
FQAPDLRGISDERLVVSSVQHQSALELSEAGVQAAAATSTAMSRMSLSSFIVNRPFLFFI
LEDSTSLPLFVGSVRNPNPGAQPERKEQQDSPDGKDSFQDHKGLPRGDKPFDPDLKLGPP
SEEDYPQPGSPK
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggcgctgctctgggggctcctggcgctcatcctctcctgcctgtcaagcctgtgctca
gcgcagttctctcctgtgagcaccatggagcccttggatctgcagctaatggacgggcag
gcccagcagaagctgcccccactttccctcctcaagctggacaaccaggagccaggtggc
cagattgccccgaagaaggccccagaagactgcaagttgtccccaacccctgagcagaca
cgcaggctggcccgggccatgatgaccttcaccacagacctcttctccctggtggcccaa
agctccaccaggcccaacctcatcctgtcacctctgagtgtggccctggccctgtctcac
ctggcactaggtgctcagaaccaaacgctgcaaaggctgaaagaggtgctgcatgcagac
tcagggccctgcctgccccacctgctcagccgcctctgccaggacctggggcctggggct
ttccggttggctgccagaatgtatctgcagaaaggatttcccatcaaagaggacttcctg
gaacaatcagaacagctctttggtgcaaagcccatgagcctgacgggaatgaagggggaa
gacctggcgaacattaaccgatgggtgaaggaggccacggaagggaagatcgaggatttc
ctctcagatctgccagatgacacagtgttgcttctcctcaatgccatccacttccagggc
ttctggaggagcaagttcgacccgaacctcacacagagaggtgctttccacctggacgag
cagttcactgtgccggtggacatgatgcaagccctcacgtatccgctgcactggttcctg
ctggagcagcctgagatccaggtggctcatttcccctttaagaacaacatgagcttcgtg
gtcctgatgcccacccgctttgagtggaacgcgtcccaggtgctagccaacctgacctgg
gacatcttgcaccagccctcgctgtcggagaggcccaccaaggtccagctgcctaagctg
catctcaaataccaactggacctggtggccaccctcagccagctgggcctgcaggagtta
ttccaggccccggacctacgtgggatctccgatgagaggctggtggtgtccagcgtgcag
catcagtcggcactagagctcagcgaggccggcgtgcaggcggccgcggcaaccagcacg
gctatgtcccgcatgtccctatcctccttcatcgtgaaccgccccttcctcttcttcatc
cttgaggacagcacgagcctgcccctcttcgtgggcagtgtgaggaaccccaacccgggc
gcgcagccggagcgcaaggagcagcaggactcccccgacggcaaggactccttccaggat
cacaaaggcctcccccgcggagacaagcccttcgacccagacttgaaacttgggccgccc
tcggaagaggattaccctcagcctggcagccccaagtga

DBGET integrated database retrieval system