KEGG   Bos indicus (zebu cattle): 109573915
Entry
109573915         CDS       T04792                                 

Gene name
PECAM1
Definition
(RefSeq) platelet endothelial cell adhesion molecule isoform X1
  KO
K06471  platelet/endothelial cell adhesion molecule
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04670  Leukocyte transendothelial migration
biu05144  Malaria
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109573915 (PECAM1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109573915 (PECAM1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109573915 (PECAM1)
  09174 Infectious disease: parasitic
   05144 Malaria
    109573915 (PECAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109573915 (PECAM1)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109573915 (PECAM1)
   04091 Lectins [BR:biu04091]
    109573915 (PECAM1)
CD molecules [BR:biu04090]
 Proteins
  109573915 (PECAM1)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Adhesion molecules of cell surface
   109573915 (PECAM1)
Lectins [BR:biu04091]
 I-type lectins (Siglecs)
  109573915 (PECAM1)
SSDB
Motif
Pfam: Ig_2 Ig_3 Ig_C17orf99 ig I-set MAP17 Ig_Tie2_1
Other DBs
NCBI-GeneID: 109573915
NCBI-ProteinID: XP_019837059
Position
19
AA seq 795 aa
MQLRWTQRGMMWLGALLTLLLCSSLKGQENSFTINSIHMQILPHSTVQNGENLTLQCLVD
VSTTSRVKPLHQVLFYKDDVLLHNVSSRRNTESYLIPHVRVCDSGRYKCTVILNNKEKTT
PEYEVWVKGVSDPRVTLDKKEVIEGGVVVVNCSVPEEKAPVHFTIEKFELNIRGAKKKRE
KTSQNQNFVTLEFTVEEQDRTIRFQCQAKIFSGSNVESSRPIQSDLVTVRESFSNPKFHI
IPEGKVMEGDDLQVKCTVQVTHQAQSFPEIIIQKDREIVAHNSLSSEAVYSVMATTEHNG
NYTCKVEASRISKVSSVVVNVTELFSKPKLESSATHLDQGEDLNLWCSIPGAPPANFTIQ
KGSMTVSQTQNFTKRVSEWDSGLYTCVAGIGRVFKRSNTVQITVCEMLSKPSIFHDSRSE
VIKGQTIEVSCQSVNGTAPIFYQLSNTSKPVANQSVGSNKPAIFRVKPTKDVEYCCSADN
CHSHSKMFSEVLRVKVIAPVDEAQLIVLKGEVEPGEPIVFYCSVNEGSFPITYKFYKEKE
SKPFYQDTINATQIMWHKTTASKEYEGQYYCTASNRANLSKHVIQSNTLTVRVYLAPWKK
GLIAVVVIGVIIVTLVLGAKCYFLKKAKAKQMPVEMSRPAVPLLNSNNEKTLSDAGTEAD
RHYGYNEDVGNHAMKPLNENKEPLTLDVEYTEVEVTSPEPHQGLGTKGTETVYSEIRKAD
PENGRLPGRVLGLREHTRLPGRMPTFREEQMIPVSQEFSALIYGPALLPPNVAIHQAKPP
VFKSILTTFMLGIKS
NT seq 2388 nt   +upstreamnt  +downstreamnt
atgcagctgaggtggacccagcggggcatgatgtggctcggagccctgctgacccttctg
ctctgttcaagcctcaaaggtcaagaaaactccttcaccatcaacagcatccacatgcag
atcctgccgcacagcacggtgcaaaacggggagaacctgacactgcagtgcctcgtggat
gtcagcaccacctcgagggtcaagcctctgcaccaggtgctgttctacaaggatgatgtg
ctgcttcacaacgtctcctccaggaggaacacagagagttatttgattccccacgtccgg
gtctgtgactcagggagatacaaatgcaccgtgatcctgaacaacaaggagaagacgacg
ccagagtatgaggtgtgggtgaaaggagtgtctgatcccagggtgacgctggacaagaag
gaggtgatagaaggtggagtcgtggtggtcaactgttctgtcccagaggaaaaggctcct
gtacatttcacaattgaaaaattcgaactaaatataaggggcgccaagaaaaaaagagaa
aaaacctctcagaaccagaattttgtgacgctggaattcacagttgaggagcaagaccgt
accatacgtttccaatgtcaagcgaagatcttttctgggtccaacgtggagtcctccaga
cccatccagagtgacctggtcactgtgcgggaatccttctcraatcccaagttccacatc
atccctgagggaaaggtcatggaaggagacgaccttcaggtcaagtgcaccgttcaggtg
acgcaccaggcccagtcattcccrgaaatcatcatccagaaggacagggagatcgtygca
cacaacagcctcagcagtgaggccgtgtactccgtgatggccacgacagagcacaacggc
aactacacctgcaaagtggaagccagccgcatatccaaagtcagcagcgtcgtggtcaac
gtcacagagctattttctaagcctaagctggagtcttcagccacacatctggaccagggc
gaagatctgaacctgtggtgctccatcccaggagcacccccggccaacttcaccatccag
aagggaagcatgactgtgtcgcagactcaaaatttcaccaagagagtttcagagtgggac
agcgggttatacacctgtgtcgcgggcatcggcagggtgttcaagagaagcaacacagtc
cagataactgtgtgtgaaatgctctccaagcccagcatttttcatgactccaggtccgag
gtgattaaaggacagaccattgaagtcagttgtcagtccgtaaacggaacggcgcccatt
ttttatcagctttcaaacacaagtaagcctgtggcraatcagagcgtgggctcaaacaag
cctgcaatattccgagttaaacccacgaaagatgtagaatactgctgcagtgcagacaat
tgccattcccacagcaagatgttcagcgaagttctgcgagtaaaggtgatagccccagtg
gatgaagcccagctcattgtcttgaagggggaggtggagcctggggagcccattgtgttt
tactgctccgtgaacgaaggatcctttcctatcacgtacaagttttacaaagaaaaggag
agcaaacccttctaccaagacaccataaatgccacccagatcatgtggcacaagaccaca
gccagcaaggaatacgagggacagtattactgcacggcctccaacagagccaacctttcc
aaacacgtgatccaaagcaacacactgaccgtcagagtctatcttgccccctggaagaaa
ggactcattgcagtggtggtcatcggagtgatcattgtcaccttggtacttggagccaaa
tgctattttctgaagaaagccaaggccaagcagatgcccgtggagatgtccaggccagcc
gtaccgcttctgaactccaacaatgagaagacattatcggatgccggtactgaagccgac
agacactatggttacaatgaagatgttggaaaccatgcaatgaagccattaaatgaaaat
aaagagccyctgaccttggacgtggagtacacagaagtggaagtgacctcccctgagcct
caccaaggtctgggaacaaagggcacggagacggtatacagtgaaatccggaaagctgat
cctgagaacggaaggctccctggacgggtcttaggactccgtgagcacacgcgcctgcct
gggaggatgcccacattccgagaagaacagatgattcccgtatcgcaagagttttctgca
cttatttatgggcctgccctgctcccaccgaacgtagcaattcatcaggccaagccacca
gtttttaaatccatcttaactacttttatgttgggtataaagagctaa

DBGET integrated database retrieval system