KEGG   Bos indicus (zebu cattle): 109573916
Entry
109573916         CDS       T04792                                 

Gene name
ACTG1
Definition
(RefSeq) actin, cytoplasmic 2
  KO
K05692  actin beta/gamma 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04015  Rap1 signaling pathway
biu04145  Phagosome
biu04210  Apoptosis
biu04390  Hippo signaling pathway
biu04510  Focal adhesion
biu04520  Adherens junction
biu04530  Tight junction
biu04611  Platelet activation
biu04670  Leukocyte transendothelial migration
biu04714  Thermogenesis
biu04810  Regulation of actin cytoskeleton
biu04919  Thyroid hormone signaling pathway
biu04921  Oxytocin signaling pathway
biu04971  Gastric acid secretion
biu05014  Amyotrophic lateral sclerosis
biu05100  Bacterial invasion of epithelial cells
biu05132  Salmonella infection
biu05135  Yersinia infection
biu05164  Influenza A
biu05205  Proteoglycans in cancer
biu05225  Hepatocellular carcinoma
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
biu05416  Viral myocarditis
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109573916 (ACTG1)
   04390 Hippo signaling pathway
    109573916 (ACTG1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109573916 (ACTG1)
  09143 Cell growth and death
   04210 Apoptosis
    109573916 (ACTG1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109573916 (ACTG1)
   04520 Adherens junction
    109573916 (ACTG1)
   04530 Tight junction
    109573916 (ACTG1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109573916 (ACTG1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109573916 (ACTG1)
   04670 Leukocyte transendothelial migration
    109573916 (ACTG1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109573916 (ACTG1)
   04919 Thyroid hormone signaling pathway
    109573916 (ACTG1)
  09154 Digestive system
   04971 Gastric acid secretion
    109573916 (ACTG1)
  09159 Environmental adaptation
   04714 Thermogenesis
    109573916 (ACTG1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109573916 (ACTG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109573916 (ACTG1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109573916 (ACTG1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109573916 (ACTG1)
   05410 Hypertrophic cardiomyopathy
    109573916 (ACTG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109573916 (ACTG1)
   05414 Dilated cardiomyopathy
    109573916 (ACTG1)
   05416 Viral myocarditis
    109573916 (ACTG1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109573916 (ACTG1)
   05135 Yersinia infection
    109573916 (ACTG1)
   05100 Bacterial invasion of epithelial cells
    109573916 (ACTG1)
  09172 Infectious disease: viral
   05164 Influenza A
    109573916 (ACTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:biu03021]
    109573916 (ACTG1)
   03019 Messenger RNA biogenesis [BR:biu03019]
    109573916 (ACTG1)
   03036 Chromosome and associated proteins [BR:biu03036]
    109573916 (ACTG1)
   03029 Mitochondrial biogenesis [BR:biu03029]
    109573916 (ACTG1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:biu04812]
    109573916 (ACTG1)
   04147 Exosome [BR:biu04147]
    109573916 (ACTG1)
Transcription machinery [BR:biu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     109573916 (ACTG1)
Messenger RNA biogenesis [BR:biu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     109573916 (ACTG1)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     109573916 (ACTG1)
    NuA4 complex
     109573916 (ACTG1)
  Chromatin remodeling factors
   BAF complex
    109573916 (ACTG1)
   PBAF complex
    109573916 (ACTG1)
   SWR1 complex
    109573916 (ACTG1)
Mitochondrial biogenesis [BR:biu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    109573916 (ACTG1)
Cytoskeleton proteins [BR:biu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     109573916 (ACTG1)
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109573916 (ACTG1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 109573916
NCBI-ProteinID: XP_019837062
Position
19
AA seq 375 aa
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaagaagaaattgccgccctcgtcatcgacaatggttctggcatgtgcaaagctggc
tttgctggggatgacgccccccgggccgtgttcccgtccatcgttgggcgtccccgacac
cagggcgtcatggtgggcatggggcagaaggacagctacgtgggcgacgaggcccagagc
aagcgtggcatcctgacccttaagtaccccatcgagcacggcatcgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaacgagctgcgtgtggcccccgaggag
caccccgtgctgctgacggaggcccctctgaaccccaaggccaaccgtgagaagatgacc
cagatcatgttcgagacgttcaacactcctgccatgtatgtggccatccaggctgtgctg
tctctgtacgcctctggccgcaccactggcattgtcatggactctggggacggggtcacc
cacacggtgcccatctacgaggggtacgccctcccccacgccatcctgcgtctggacctg
gctggccgggacctgacagactacctcatgaagatcctcacggaacgtggttacagcttt
accaccacagccgagcgggaaattgtgcgtgacatcaaggagaagctctgctacgtcgcc
ctggacttcgagcaggagatggctacygctgcatcctcctcctccttggagaagagctat
gagctgcccgatggtcaggtgatcaccattggcaatgagcggttccggtgtcccgaggca
ctcttccagccgtccttcctgggtatggagtcctgtggcatccatgagaccaccttcaac
tccatcatgaagtgtgacgtggacatccgaaaggacctgtatgccaacacggtgctgtct
ggtgggaccaccatgtaccctggcatcgctgacaggatgcagaaggagatcaccgcgctg
gctccaagcacgatgaagatcaagatcattgctcctccygagcgcaagtactcggtgtgg
atcggaggctccatcctggcctccctgtccaccttccagcagatgtggatcagcaagcag
gagtatgacgagtctggcccctccattgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system