KEGG   Bos indicus (zebu cattle): 109573936
Entry
109573936         CDS       T04792                                 

Gene name
ICAM2
Definition
(RefSeq) intercellular adhesion molecule 2 isoform X1
  KO
K06523  intercellular adhesion molecule 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109573936 (ICAM2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109573936 (ICAM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109573936 (ICAM2)
   04091 Lectins [BR:biu04091]
    109573936 (ICAM2)
CD molecules [BR:biu04090]
 Proteins
  109573936 (ICAM2)
Lectins [BR:biu04091]
 I-type lectins (Siglecs)
  109573936 (ICAM2)
SSDB
Motif
Pfam: ICAM_N PspB
Other DBs
NCBI-GeneID: 109573936
NCBI-ProteinID: XP_019837097
Position
19
AA seq 351 aa
MALTSLLPTEPASRGPKDSFRPGXKGLKPGSEIRSSPGNXGCWKLDLSHPVYPSQHHPFA
DTGSPQXFPVSLRTPPKMSPFGGWGMLAAFLAMLCCQGSGEKAFEGPEHLMVGSGEXQXI
NCTASCTDPTNLILETXLNKTLLXSQAQWKLFQVYNISKDEZLLCSFTCAGKQEMKVFNI
TVFYPPKQVLLTLSHTSVAXGTLFTIECMVPAVAPLEGLTVTLLRGTEILHNQTFEETAP
FPHDAVVTHXTTAHREDGHHNFSCEAQMDLRSRGGGLVHRVSDPQRLEVKEPEPNYQMVI
MAXVIVLLLLFVTFVXLCFVFSEKWRRGRTGHYPVQAAWNRLRRSHRAQPL
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggctctgacttctctcctgccaacagagccagcatccaggggcccaaaagactccttc
agaccgggctrtaaggggctcaaacctggatcagagatcaggagcagcccaggaaacarc
ggctgctggaagctggacctcagccaccctgtttacccatcacagcatcacccgtttgct
gatacaggcagtcctcagcygttccctgtgagcctgcggacgccacccaagatgtcccct
tttggtggctggggaatgctcgcagcctttctsgctatgctctgctgccaagggtctggt
gagaaggcgttcgagggcccagagcacctgatggtggggtctggagagkttcaartgatt
aattgcactgccagttgtacggaccccacgaaccttattctagagacasmcctaaacaag
actctcctggasagccaggctcagtggaagctgttccaggtctacaacatctccaaggat
gagsagctcctgtgcagtttcacctgcgccggmaagcaggagatgaaagttttcaacatc
accgtgttctaccctccaaagcaagtgctgctgacgctgtcscacacctcagtggccrta
gggacactgttcaccatcgagtgcatggtccccgccgtggcaccccttgaaggcctcact
gtcaccctgctccgtggtactgagatcttgcacaatcagacctttgaggagacagcaccc
ttcccccacgatgccgtggtcacccacmacaccacagctcacagggaagacggccaccat
aacttctcgtgcgaggcccagatggacctgcgctctcgtggcggtggccttgtccacaga
gtctcagatccccagaggcttgaagtcaaagagcccgagcccaactatcagatggtgatc
atggcgaycgtgatagtgctgctgctcttgtttgtgacattcgtcytcctgtgctttgtc
ttcagcgagaagtggcgccgggggcggacaggtcattacccagtgcaggccgcttggaac
aggctgagacggagccaccgggcacagcccctgtga

KEGG   Bos indicus (zebu cattle): 109573938
Entry
109573938         CDS       T04792                                 

Definition
(RefSeq) intercellular adhesion molecule 2-like isoform X1
  KO
K06523  intercellular adhesion molecule 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109573938
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109573938
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109573938
   04091 Lectins [BR:biu04091]
    109573938
CD molecules [BR:biu04090]
 Proteins
  109573938
Lectins [BR:biu04091]
 I-type lectins (Siglecs)
  109573938
SSDB
Motif
Pfam: ICAM_N
Other DBs
NCBI-GeneID: 109573938
NCBI-ProteinID: XP_019837099
Position
19
AA seq 286 aa
MRGNTIQLTESWEFRTAAGHPFLTSALHVSPGSPQLFPANLWTPPEMSPFGGWXTLAAFL
ALLCCRGSGEEQFEVPMEPNHLLVGSGEFQVINFTASCTDPKKLVLETALHKTFLEDQAQ
WKLFKVISISKNMELMCSFICGGKEGMKVFNITXFYPPKQVLLTLSHTSVAVGTLFTIEC
XVPAVAPLEGLXVTLLXGTEILYNQTFVGTARFPQDAVVTHXTTAHREDGLHNFSCEAQM
DLRSPGGGLVHRVSDPQRLEVKEPXPSNQMVIMAXVIVLLLLFWFK
NT seq 861 nt   +upstreamnt  +downstreamnt
atgagaggaaatacgatacagcttacagaaagctgggagttccggactgccgctggtcac
cccttcctgaccagtgcccttcacgtctctccaggcagtcctcagctgttccctgcaaac
ctgtggacgccacccgagatgtccccttttggtggctgggraacgctcgcagcctttctc
gccctgctctgctgccgaggttctggtgaggagcagttcgaggtacccatggagccaaac
cacctgttggtggggtctggagagtttcaggtgattaattttactgccagttgtacrgac
cccaagaaacttgttctggagacagccctacacaagactttcctggaggaccaagctcag
tggaagttgttcaaggtcatcagcatctccaagaacatggagctcatgtgcagtttcatc
tgcggcggcaaggaggggatgaaagttttcaacatcaccktgttctaccctccaaagcaa
gtgctgctgacgctgtcgcacacctcagtggccgtagggacactgttcaccatcgagtgc
akggtcccygccgtggcacccctcgaaggcctcastgtcaccctgctcygtggtactgag
atcttgtacaatcagacctttgtggggacagcacgtttcccccaagatgccgtggtcacc
cacmacaccacagctcacagggaagacggcctccataacttctcgtgcgaggcccagatg
gacctgcgctctcctggcggtggccttgtccacagagtctcagatccccagaggcttgaa
gtcaaagagcccgwgcccagcaaccagatggtgatcatggcgawcgtgatagtgctgctg
ctcttgttctggttcaaataa

DBGET integrated database retrieval system