KEGG   Bos indicus (zebu cattle): 109574052
Entry
109574052         CDS       T04792                                 

Gene name
ERN1
Definition
(RefSeq) serine/threonine-protein kinase/endoribonuclease IRE1
  KO
K08852  serine/threonine-protein kinase/endoribonuclease IRE1 [EC:2.7.11.1 3.1.26.-]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04140  Autophagy - animal
biu04141  Protein processing in endoplasmic reticulum
biu04210  Apoptosis
biu04932  Non-alcoholic fatty liver disease
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05016  Huntington disease
biu05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109574052 (ERN1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109574052 (ERN1)
  09143 Cell growth and death
   04210 Apoptosis
    109574052 (ERN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109574052 (ERN1)
   05012 Parkinson disease
    109574052 (ERN1)
   05014 Amyotrophic lateral sclerosis
    109574052 (ERN1)
   05016 Huntington disease
    109574052 (ERN1)
   05017 Spinocerebellar ataxia
    109574052 (ERN1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109574052 (ERN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109574052 (ERN1)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109574052 (ERN1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     109574052 (ERN1)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: Other
  IRE family
   109574052 (ERN1)
SSDB
Motif
Pfam: Pkinase Ribonuc_2-5A PK_Tyr_Ser-Thr PQQ_2 PQQ Pkinase_fungal APH Kdo Band_3_cyto
Other DBs
NCBI-GeneID: 109574052
NCBI-ProteinID: XP_019837327
Position
19
AA seq 976 aa
MLVRLLLLLLLLALLLPXPGGFGSPSTVTLPETLLFVSTLDGSLHAVSKRTGSIKWTLKE
DPVLQVPTHVEEPAFLPDPNDGSLYTLGGKNNEGLTKLPFTIPELVQASPCRSSDGILYM
GKKQDIWYVIDLLTGEKQQTLSSAFADSLCPSTSLLYLGRTEYTITMYDTKTRELRWNAT
YFDYAAALPEDGGDYKMSHFVSNGDGLVVTVDSESGDVLWIQNYASPVVAFYIWQREGLR
KVMHINVAVETLRYLTFMSGEVGRITKWKYPFPKETEAKSKLTPTLYVGKYSTSLYASPS
MVHEGVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPSTDLKFDPGLKGKSKLNYLRNY
WLLIGHHETPLSASTKMLERFPNNLPKHRENVIPADSEKKSFEEVIDLVDQTSENAPTTV
SPDVEEKFDHAPAKPEAPVDSMLKDMATIILSTFLLIGWVAFIITYPLSIHQQRQLQHQQ
FQKELEKIQLLQQQQLPFHPPGDAAQDAELQDSSGQYSESSATSSPSTSPRASNHSLHST
GCTSKAVTSPFLEQDDEDEETGMVIVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKR
ILPECFSFADREVQLLRESDEHPNVIRYFCTERDRQFQYIAIELCAATLQEYVEQKDFAH
LGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILLSMPNAHGRIKAMISDFGLCKKLAV
GRHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSLQ
RQANILLGAYSLDCLHPEKHEDVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQLQ
FFQDVSDRIEKEALDGPIVKQLERGGRAVVKMDWRENITVPLQTDLRKFRTYKGSSVRDL
LRAMRNKKHHYRELPEEVQQTLGALPDDFVRYFTSRFPHLLSHTYRAMELCRHERPFQPY
YHEPPEPQPPVTADAL
NT seq 2931 nt   +upstreamnt  +downstreamnt
atgcttgtccgattgctgctgctgctgctgctgctggcattgctgttgccckgccccggg
ggttttgggagtcccagcactgtgacacttcctgaaaccttgctgtttgtgtccacattg
gatggaagtctgcatgccgtcagcaagaggacaggctccatcaaatggactttaaaggaa
gatccagtcctgcaggttccaacacacgtggaagagcctgccttcctcccagatcccaac
gatggcagcctgtacacgcttgggggcaagaacaacgaaggcctgacgaaacttcccttt
acgatccctgagttggtgcaggcatctccgtgccgaagttcagatggcattctctacatg
ggtaaaaagcaggacatttggtacgttatcgacctcctgactggggagaagcagcagacc
ctgtcatcagcctttgcagacagcctctgcccatcaacctctcttctgtatctggggcga
acagagtacaccatcaccatgtacgacaccaagacccgcgagctgcgctggaacgccacc
tacttcgactacgcrgccgcgctgcccgaggacggtggggactacaagatgtcccacttt
gtgtccaatggcgatgggctggtggtgacggtggacagcgagtctggggacgtcctgtgg
atccaaaactatgcttcccccgtggtggccttttacatctggcagcgcgagggcctgcgg
aaggtgatgcacatcaacgtcgccgtggagaccctgcgctacctgaccttcatgtcgggg
gaggtggggcgcatcaccaagtggaagtacccrttccccaaggagacagaggccaagagc
aagctgacgcccaccctgtatgtggggaaatactccaccagcctctatgcttccccctcg
atggtgcatgagggcgtcgccgttgtgccccggggcagcacccttcctttgctggaaggc
ccccagaccgacggtgtcaccatcggggacaaaggggagtgtgtgatcacgcccagcacg
gacctgaagttcgacccaggactcaaaggcaagagcaagctcaactacctgcggaactac
tggctgctcatcggacaccacgaaaccccactgtccgcgtccaccaagatgctggagcgc
ttccccaacaacctgcccaaacaccgggagaacgtgattcccgccgactcggagaagaag
agctttgaggaggtcattgacctggttgaccagacttcagaaaatgcacctaccacggtt
tctccggacgtggaagagaagttcgatcatgcccctgccaagcccgaggcccctgtggac
tccatgctcaaggacatggccaccatcatcctgagcaccttcctgctcatcggctgggtg
gctttcatcatcacctaccccctgagcatccaccagcagcgacagctccagcaccagcag
ttccagaaggaactggagaagatccagctcctgcagcagcagcagctgcccttccacccg
cccggggacgcggcacaggacgccgagctccaggactcatccggccagtactcggagagc
tcggccaccagcagccccagcacgtccccccgagcctccaaccactcgctccactccacc
ggctgcacctccaaggctgtcaccagccccttcctggagcaggacgatgaggatgaggag
accggcatggtgatagttgggaaaatctccttctgtccaaaggatgtcctgggccatgga
gctgagggcacgatcgtgtaccggggcatgtttgacaaccgtgacgtggcagtcaagagg
atcctgcccgagtgtttcagtttcgcggaccgtgaggtccagctgctgagagagtcggac
gagcacccaaacgtgatccgctacttctgcactgagagggaccggcagttccagtacatc
gccatcgagctgtgcgcggccacgctgcaggagtacgtggagcagaaggatttcgcccac
ctcggcctggagcccatcaccctgctgcaacagaccacctcgggcctggcccacctgcac
tccctcaacatcgttcacagagacctgaagccccacaacatcctcctctccatgcccaac
gcacatggcaggatcaaggccatgatctccgacttcggcctctgcaagaagctggccgtg
ggcaggcacagcttcagccgccgctcgggggtgccgggcaccgaaggttggattgccccg
gagatgctgagcgaagactgcaaggagaaccccacctacacggtggacatcttctccgcg
ggctgcgtcttctactacgtgatatctgagggcagccacccctttggcaagtccctgcaa
cgccaggccaacatcctcctgggtgcctacagccttgactgcctgcacccagagaagcat
gaggacgtcattgcccgggaattaatagagaagatgatcgccatggacccccagaagcgc
ccgtcagcgaagcatgtgctgaaacaccctttcttctggagcctggaaaagcagctccag
ttcttccaggacgtgagtgaccggatagagaaagaggccctggacggcccgatagtgaag
cagctggagcgcggcgggcgggccgtggtgaagatggactggcgggagaacatcaccgtc
cccctgcagacagatctgcggaaattcagaacctataaaggcagttcggtccgagatctc
ctcagagccatgaggaataagaagcaccactaccgggagctgcccgaggaggtgcagcag
acgctgggcgccctccctgacgacttcgtgcgctacttcacctcccgcttcccccaccty
ctctcacacacctaccgtgccatggagctgtgccgccacgagaggcccttccagccctac
taccacgagccccccgagccccagccccccgtgactgcagacgccctctga

DBGET integrated database retrieval system