KEGG   Bos indicus (zebu cattle): 109574217
Entry
109574217         CDS       T04792                                 

Gene name
SEPT4
Definition
(RefSeq) septin-4 isoform X1
  KO
K16943  septin 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109574217 (SEPT4)
   04215 Apoptosis - multiple species
    109574217 (SEPT4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109574217 (SEPT4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:biu04812]
    109574217 (SEPT4)
Membrane trafficking [BR:biu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    109574217 (SEPT4)
Cytoskeleton proteins [BR:biu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     109574217 (SEPT4)
SSDB
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase GTP_EFTU AIG1 VirE AAA_16 Ras Roc AAA_22 AAA_29 ABC_tran AAA_23
Other DBs
NCBI-GeneID: 109574217
NCBI-ProteinID: XP_019837631
Position
19
AA seq 477 aa
MDRSLGRQGGSVPEERAEAGIKRFLEDSDDAELNKFVTDFPGSETYHPPEAKTLVPRPQI
QEPRPQASDLCQDDLEFKPPSWPQPSDSQQYFSASAPLSPSARPRSPWGKLDPYDSSEDD
KEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLSAEER
IMQTVEITKHAVDIEEKGVKLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDES
GLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVER
KKRKIREEIEHFGIKVYQFPDCDSDEDEDFKSQDLALKESIPFAVIGSNTVVEARGRRVR
GRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVK
ERNRNKLTLESGTDFPLPAVPPGTDPETERLIREKDEELRRMQEMLHKIQRQMKETH
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggaccgttccctgggacggcaaggcggttctgtccctgaggagagggctgaagctggg
atcaagcgctttctggaggactcggatgacgcagaactgaacaagttcgtgacggatttc
ccaggaagcgagacctaccacccaccagaggccaagaccttggtgcccaggccccaaatc
caggagccgaggccccaggcttcagacctctgccaggatgacctggagttcaaacccccc
tcgtggccccagccctctgacagccagcagtacttctctgcctcagcccccctcagcccc
tcagcccggccccgcagcccgtggggcaagctcgatccctatgactcctccgaggatgac
aaggagtacgtgggctttgcgaccctccccaatcaggtccaccggaagtctgtgaagaaa
ggctttgactttacccttatggtggcaggagagtcgggcctggggaagtccacgctggtc
aacagcctcttcctcacggatctgtaccgggaccggaagctcctcagtgcagaagagcgt
atcatgcagacggtggagatcactaagcacgctgtggacatagaagagaagggcgtgaag
ctgcggcttaccattgtggacacaccaggttttggggacgccgtcaacaacacagagtgc
tggaagcctgtggccgaatacatcgaccagcagtttgagcagtatttccgagatgagagt
ggcctgaaccgcaagaacattcaagacaacagggtgcactgctgcctgtacttcatctcg
cccttcggccatgggctccggccattggatgttgaatttatgaaggccctgcatcagcgg
gtcaacatcgtgcctatcttggccaaggcggacacactgacacctcctgaagtggagcgc
aagaaacgcaaaatccgggaggagattgagcactttggaatcaaggtctaccagttccca
gactgtgactctgatgaggatgaggacttcaaatcacaggacctggccctaaaggaaagc
atcccatttgctgtcattggcagcaacactgtggtagaggccagagggcgtcgagttcgg
ggccggctctacccctggggcatcgtggaagtggaaaacccagggcactgcgactttgtg
aagctgaggacaatgctggtgcgtactcacatgcaggacctgaaggacgtgacgcgggag
acacattatgagaactaccgggcacagtgcatccagagcatgacccgcctggtggtgaaa
gaacggaatcgcaacaaactgactctagagagtggtaccgactttccccttcctgccgtc
ccaccagggacagatccagaaactgagaggctgatccgagagaaagatgaggagctgcgg
cggatgcaggagatgctgcacaaaatccagagacagatgaaggagacccattag

DBGET integrated database retrieval system