KEGG   Bos indicus (zebu cattle): 109574379
Entry
109574379         CDS       T04792                                 

Gene name
VTN
Definition
(RefSeq) vitronectin
  KO
K06251  vitronectin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04512  ECM-receptor interaction
biu04610  Complement and coagulation cascades
biu05165  Human papillomavirus infection
biu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109574379 (VTN)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109574379 (VTN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109574379 (VTN)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109574379 (VTN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109574379 (VTN)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109574379 (VTN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109574379 (VTN)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109574379 (VTN)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109574379 (VTN)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   109574379 (VTN)
SSDB
Motif
Pfam: Hemopexin Somatomedin_B
Other DBs
NCBI-GeneID: 109574379
NCBI-ProteinID: XP_019837935
Position
19
AA seq 476 aa
MTSLRPLLMLALLAWVVVADQESCKGRCTEGFNATRKCQCDELCSYYQSCCADFMAECKP
QVTRGDVFHLPEDEYGFHDYSDAQTVNSNVEAQPESTTLASVLQAQTLETPVQAPVLNPE
KEVPPPGRGDSEPGMGTSDLETSESPAEEETCSGKPFDAFTDLKNGSLFAFRGLYCYELD
EKAVRPGYPKLIRDVWGIEGPIDAAFTRVNCQGKTYLFKGSQYWRFQDGVLEPDFPRNIS
DGFGGIPDDVDAALALPAHNFNGRERVYFFKGNHYWEYVFQQQPSQEDCEGSSLPAAFKH
FALMQRDSWVDIFRLLFWGGSYGGAGQPQLISRNWFGLPGRLDAAMAGHIYVSGSAPSFP
RAKMTKSARRHRKRYRSLRSRGRGRGRNQNPYRRSRSAFLSWLSSEELGLGANNYDSFEM
DWLVPATCEPIQSVYFFSEDKYYRVNLRTRRVDAVIPPYPRSIAQYWLGCPVPGQA
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgacatccctaaggccccttctgatgctggccctgctggcgtgggttgttgtggctgac
caagagtcctgcaagggccgctgcaccgagggcttcaacgccaccaggaagtgtcagtgt
gacgagctctgttcttactaccagagctgctgtgccgacttcatggctgagtgcaagccc
caagtgactcgtggggatgtgttccatctgccagaagatgagtatgggttccatgactac
agcgacgcgcagaccgtcaacagcaacgtggaagcacagcccgagagcaccacyctggcc
tctgttctgcaggctcagaccctagagactcctgtccaggcaccagttctcaaccctgag
aaagaggtcccaccacctgggcggggagactcagagcctgggatggggaccagtgaccta
gagacctctgagtccccagcagaggaggagacgtgcagtgggaaaccctttgatgccttc
actgacctcaagaatggttccctctttgccttccgagggctgtactgctatgagctggat
gaaaaggcagtgaggcctggataccccaaactcatccgagatgtctggggcattgagggg
cccattgatgctgccttcacccgtgtcaactgtcagggaaagacatacctcttcaagggt
agtcagtactggcgctttcaggacggtgtcctggagcctgacttcccccgaaacatctcg
gacggcttcgggggtattccggatgatgtggacgcagccttggccctccccgctcacaac
ttcaatggcagggagcgggtctacttcttcaagggcaaccactactgggaatatgtgttc
cagcagcagcccagtcaagaggattgtgaaggcagctccctgccggccgcatttaaacac
tttgccctgatgcagcgggacagctgggtggacatcttccgacttctcttctggggcggt
tcctatggtggtgctggacagccccagctcatcagccgcaactggtttggtctgccggga
cgactggatgcggccatggccggccacatctatgtctcaggctcagctcccagcttcccc
cgggccaagatgactaagtctgcacgccgccatcgcaaacgctaccgctcgctccgaagc
cgtggtcgaggccgaggccgaaaccagaacccctaccggcgatctcgatctgccttcctg
tcctggctctccagcgaggagctgggcctgggagccaacaactatgatagcttcgagatg
gactggcttgtgcctgccacctgtgagcccatccagagtgtctacttcttctcagaagac
aagtactaccgagtgaaccttcgcacacggcgggtggacgctgtgatccctccctaccca
cgctccatcgcccagtactggctgggctgtccagtccctggccaagcgtag

DBGET integrated database retrieval system