KEGG   Bos indicus (zebu cattle): 109574747
Entry
109574747         CDS       T04792                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
biu  Bos indicus (zebu cattle)
Brite
KEGG Orthology (KO) [BR:biu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109574747 (AHRR)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109574747 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 109574747
NCBI-ProteinID: XP_019838282
Position
20
AA seq 696 aa
MIPPGECLYAGRKRRKPVQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPLPPDIISK
LDKLSVLRLSVSYLRVKSFFQALQERCPRQPVAAAPSPGERGPRGGSAGSTVLEGRLLLE
SLHGFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDP
PQAGCGQPLLSETGEDAVLGRLLRAQEGGADPPTEYSAFLTRCFICRVRCLLDSTSGFLT
MQFQGRLKFLFGQNRRAPSGAALLPRLALFCVVAPLALPPGVEVRVKTVYLRAKHRADVP
ASTDAKAKAASSLCESELLGNTNYSAGRSNGENGLSLFRTPEDACRWGRVTARGPCLCLR
GGPDLVLDPDGTSGAEEGEELGGLPRDAPPYSCRLESLGPVKHLDWAAGRHGQDDGSAKL
KLEPGKADPFPTAPAHGACLPYLGAQGTVHSLRSSPSSHPPRPPPGACASRTSRALRDGH
QGPAPPPTPGPFPQGGLDSRVPRPAVQRLPVGGYPAEDKLRGLLMPPGAPSHPALSLDVP
IKMESDSGSEDAADGYRMSPAQVWLGAGNPAKRQLVTFPTRMHLKTEPGARLPLYTPPPG
PGLLGAPPRPGRGLAPLHPTSCACLEPPPRLCMRGHQPFNLGCNCRAPGPAPAVKLEPLD
SPLWAAHGQGGPPGLFSKSAPAAGMPPRDTQCAFLP
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgatcccaccgggggagtgcctgtacgccgggagaaaacgcaggaagcccgttcagaaa
cagaggcctgccgtgggcgctgagaagtcgaacccttccaagcggcaccgggaccgcctc
aatgccgagctggaccacctggccagcctgctgccgctgccgcccgacatcatctctaag
ctcgacaagctttctgtcctgcgtctcagcgtcagctatctcagggtgaaaagcttcttc
caagccctgcaggagaggtgcccgaggcagccggtggctgctgccccctcgccgggagag
cggggtccacgcggagggtctgcaggctcgactgtgctggagggaaggctgctgctggag
tccctccacggcttcgctctggtggtgagcgcggaagggatgatcttctacgcgtcggcc
acgatcgtggactacctgggcttccaccagacagatgtgatgcaccagaatatttatgac
tacatccacgtggatgaccgccaggacttctgccggcagctgcactgggccatggaccct
ccccaggcagggtgcgggcagccactactctcggagacaggagaggatgccgtcctgggg
aggctgctccgggcccaggaggggggcgcagacccgcccaccgagtactcggccttcctg
acacgctgcttcatctgccgcgtgcgctgcctgctggacagcacctcgggcttcctgacg
atgcagtttcaaggacgactgaagttcctcttcggtcagaacaggcgggcgccctcgggc
gcagccctgctcccgcggctggccctgttctgcgtggtggcccccctggccctgccgccg
ggcgtggaggtgagggtgaagaccgtgtacctgagggcgaagcacagggcggacgtcccg
gcctctaccgacgcaaaagcaaaagctgcctcaagtctctgcgaatcagaattgcttgga
aacaccaattactcagcagggagaagcaatggagaaaatggcctttccttgttcaggaca
ccagaggacgcctgccgctggggccgggtcacagcccggggcccctgcctgtgcctccgg
ggtggccctgaccttgtccttgaccccgatggcacctcaggggcagaggaaggagaggag
ctcggggggctcccgcgggacgcgcccccttacagctgccgcctggagtccctgggccct
gtgaagcacctggactgggcggccgggaggcacggtcaggacgatggcagcgccaagctg
aagctggagcccgggaaggctgacccgttccccaccgccccggcccacggcgcctgcctg
ccctacctgggtgcgcaaggcaccgtccactccctccggagctcacccagctctcaccca
cccaggccgccccccggggcctgcgccagccggaccagcagagccctgcgggacgggcac
cagggcccagcgccgccccccacacccggccccttcccccaggggggcctggacagcagg
gtccctcggccagcagtccagcgtctcccggtgggcggctaccccgctgaggacaagctg
cgaggccttctgatgcccccgggagccccgagtcaccccgcgttgtcactcgatgtgccc
atcaagatggagagtgactcagggtccgaggacgcggcggacggctaccgcatgtcccca
gcccaggtgtggctgggggccggcaatccggccaagagacagctggtcaccttccccact
aggatgcaccttaagacggagccgggcgccaggctccccctgtacaccccacccccaggg
cctggcctgctgggcgccccccccagacccggcagggggctggccccgctgcaccccacg
tcctgtgcctgcctggagcccccaccccgcctctgcatgcggggccaccagcccttcaac
ctgggctgcaactgccgggctcccgggccagctcccgcagtcaagctcgagcccctagac
tcgcccctgtgggcagctcayggccagggcgggccgcctgggctgttctccaagagcgcc
ccggccgcggggatgccccccagggacacgcagtgcgccttcctgccctag

DBGET integrated database retrieval system