KEGG   Bos indicus (zebu cattle): 109574987
Entry
109574987         CDS       T04792                                 

Gene name
OCLN
Definition
(RefSeq) occludin
  KO
K06088  occludin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109574987 (OCLN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109574987 (OCLN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109574987 (OCLN)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109574987 (OCLN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109574987 (OCLN)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:biu02000]
    109574987 (OCLN)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109574987 (OCLN)
Transporters [BR:biu02000]
 Other transporters
  Others
   109574987 (OCLN)
SSDB
Motif
Pfam: MARVEL Occludin_ELL UPF0182 DUF4164 Laminin_II APG6_N FapA TMF_TATA_bd Spc7 Swi5 GAS DivIC
Other DBs
NCBI-GeneID: 109574987
NCBI-ProteinID: XP_019838613
Position
20
AA seq 522 aa
MSSRPFESPPPYRPDEFKPNHYTPSNDJYSGEMHVRPMLSQPAYSFYPEDEILHFYKWTS
PPGVIRILSMLVIVMCIAIFACVASTLAWDRGYGTLMGAGVNYPYAGSAFGSYGSGYGYG
YGYGYGYGTGYTDPRAAKGFLLAMAAFCFIAALVIFVTSVVRSGISRTRRYYLTVIIVTA
VLGIMMFIATIVYIMGVNPTAQASGSLYSSQIYALCNQFYTPAATGLYVDQYLYHYCVVD
PQEAIAIVLGFMVIVAFALMIFFAVKTRRKMNRYDKSNILWDKERIYDEQPPNVEEWVKN
VSAGTQDMPPPLSDYVERVDSPVAYSSNGKVNEKRPYPESSYKSTPVPEVAQELPLTSPV
EDFRQPHYSSSGNLETLSKRAPAKGRAGKSRRAEQDHYETDYTTGGESCDELEDDWIREY
PPITSDQQRQLYKRSFDTGLQEYKSLQAELDEVNKELSRLDKELDDYREESEEYMAAADE
YNRLKQVKGSADYKSKRNYCKQLKSKLSHIKKMVGDYDRRKT
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgtcatccaggccttttgaaagtccacctccttatagacctgatgaattcaaacctaat
cactacacaccaagcaatgacmtatatagtggagagatgcacgttcgaccmatgctctct
cagccagcatattccttctacccggaagatgaaattctccacttctacaaatggacctct
cctcccggagtaattcggatcctgtctatgcttgttatcgtgatgtgcatcgccattttc
gcctgtgttgcctccactcttgcctgggacagaggctatggaaccttaatgggagctggt
gttaactacccttatgcaggaagtgcctttggtagctacggaagtggctatggctacggc
tatggctacggttatggctatggaacaggctatacagatcccagagcggcaaagggattc
ctgctggccatggctgccttttgtttcattgctgcattggtgatatttgttaccagcgtt
gtaaggtcaggcatatctagaacaagaaggtattatttgactgtgataatagtgaccgcc
gtcctgggcattatgatgtttattgccacaattgtctatataatgggagtcaatccaact
gcccaggcctctgggtctctctacagttcacagatatatgccctctgcaaccagttttat
acacctgcagctactggactctacgtggatcaatatttatatcactactgtgtggtggat
ccccaggaggccattgccattgtactggggttcatggttattgtggcttttgctctaatg
attttctttgctgtgaaaactcgaagaaagatgaaccgctatgacaagtcaaatattctg
tgggacaaggaacgtatttatgatgagcagcctcccaatgttgaagagtgggttaaaaac
gtttctgcaggtacacaagacatgcctcctcccctctccgactacgtggagagagtggac
agcccagtggcctactcctccaatggtaaagtgaacgagaagcgaccgtatccagagtct
tcctataaatcaaccccggtgccggaagtggctcaggagctgccattgacttcacctgtg
gaggacttccggcagcctcattacagcagcagtggtaacttggagacgctttcaaaaagg
gctcccgcgaagggcagggcagggaagtcaaggcgggcagagcaagaccactatgaaaca
gactacacgaccggaggcgagtcctgcgatgagctggaggacgactggatcagggaatat
ccacctatcacttcagatcaacaaagacaactctacaagagaagttttgacactggccta
caggaatataagagcctacaagcagaacttgatgaggtcaataaagaactctctcgtctg
gataaagaactggatgactatagagaagaaagtgaagagtacatggctgctgctgacgag
tacaatagactgaaacaagttaagggatcagccgattacaaaagtaagaggaattactgt
aaacagttgaagagcaaattgtcacacattaagaagatggttggagattacgatcgacgg
aaaacatag

DBGET integrated database retrieval system