KEGG   Bos indicus (zebu cattle): 109575240
Entry
109575240         CDS       T04792                                 

Gene name
BDKRB1
Definition
(RefSeq) B1 bradykinin receptor
  KO
K03915  bradykinin receptor B1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04020  Calcium signaling pathway
biu04080  Neuroactive ligand-receptor interaction
biu04610  Complement and coagulation cascades
biu04750  Inflammatory mediator regulation of TRP channels
biu04810  Regulation of actin cytoskeleton
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109575240 (BDKRB1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109575240 (BDKRB1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109575240 (BDKRB1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109575240 (BDKRB1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109575240 (BDKRB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109575240 (BDKRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109575240 (BDKRB1)
G protein-coupled receptors [BR:biu04030]
 Rhodopsin family
  Peptide
   Bradykinin
    109575240 (BDKRB1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 109575240
NCBI-ProteinID: XP_019838808
Position
21
AA seq 352 aa
MASWALLELQTLNQSQPLPPNTTSCDEAWEAWALLHRVLPTCVLSICLCGLLGNLFVLSV
FLVARRRLNTAEIYLANLAASDLVFVLGLPFWAENIRNEFNWPFGALLCRLVNGIIKANL
FISVFLVVAISQDRYCVLVHPMASRRQRRRRRAQGTCLLIWAVGALLSLPTFLLRSVKAV
PELNVSACVLRYPHDAWPFVRMVELTLLSFLLPLAAIVFFNCHILAALRGRRQISRTRCG
GPREGRTTALILTLVSAFLLCWAPYHFFAFLEFLFQVRAVRGCFWENFIDLGLQCANFFA
FVNSCLNPVIYVFWGQLFRTKVWELYKQCIPGSLTPVASSHRTEILQLFWRN
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggcgtcctgggccctcctggagctccagactctcaaccagagccagcccctgcccccg
aacaccacatcctgtgacgaagcttgggaagcctgggccctgctgcacagagtgctgccc
acctgcgtyctctccatctgcctctgcgggctgctggggaacctctttgtgttgtccgtc
ttcctcgtggctcgacggcgtctgaacacggcagaaatctacctggccaacctggcggct
tctgacctggtgttcgtcttgggcttgcccttctgggcrgagaacatccggaacgaattc
aactggcctttcggagcgctcctctgccgcctggtcaacggcatcatcaaggccaacctc
ttcatcagcgtcttcctggtcgtggccatcagccaggaccgatactgtgtgctggtgcac
cccatggccagccggaggcagcggcggcggcggcgggcccagggcacctgtctgctcatc
tgggccgtgggggccctcctgagtctccccacattcctgctgcgctctgtcaaggctgtg
ccagagttgaatgtctccgcctgcgtgctgcggtacccccacgacgcctggccctttgta
aggatggtggagttaaccctgctgagttttctcctccccttggctgcgatcgttttyttc
aactgtcacattctggcagccctgcgggggcggcggcagatcagcaggacgaggtgtgga
gggcccagggagggcaggaccaccgccctgatcctcaccctcgtgtccgccttcctgctc
tgctgggcgccctaccacttctttgccttcctggaatttctgttccaggtgagggctgtc
agaggctgcttctgggagaatttcatcgatctgggcctgcaatgtgccaacttctttgct
ttcgtcaacagctgcctgaatccagtaatttatgtcttttggggccagcttttcaggacc
aaagtctgggaactttataaacaatgcattcctgggagtcttactccagtagcctcgtct
cataggacagagatcctccaacttttctggcggaattaa

KEGG   Bos indicus (zebu cattle): 109575666
Entry
109575666         CDS       T04792                                 

Gene name
BDKRB2
Definition
(RefSeq) B2 bradykinin receptor
  KO
K03916  bradykinin receptor B2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04071  Sphingolipid signaling pathway
biu04080  Neuroactive ligand-receptor interaction
biu04610  Complement and coagulation cascades
biu04750  Inflammatory mediator regulation of TRP channels
biu04810  Regulation of actin cytoskeleton
biu04961  Endocrine and other factor-regulated calcium reabsorption
biu05142  Chagas disease
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109575666 (BDKRB2)
   04071 Sphingolipid signaling pathway
    109575666 (BDKRB2)
   04022 cGMP-PKG signaling pathway
    109575666 (BDKRB2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109575666 (BDKRB2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109575666 (BDKRB2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109575666 (BDKRB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    109575666 (BDKRB2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109575666 (BDKRB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109575666 (BDKRB2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109575666 (BDKRB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109575666 (BDKRB2)
G protein-coupled receptors [BR:biu04030]
 Rhodopsin family
  Peptide
   Bradykinin
    109575666 (BDKRB2)
SSDB
Motif
Pfam: 7tm_1 DUF2976 DUF2794
Other DBs
NCBI-GeneID: 109575666
NCBI-ProteinID: XP_019839492
Position
21
AA seq 388 aa
MFSAWRRPMFLSIHEDTVPTTASFGAEMFNLTSQVLEPALNGTLPEGSSCFQSDLWNWLN
TIQPPFLWILFLLAALENTFVLSVFCLHKSSCTVAEIYLGNLAVADLILACGLPFWAITI
ANNFDWLFGEALCRVVNTILYMNLYSSIYFLMLVSIDRYLALVKTMSMGRMRGVRWAKLY
SLVIWGCALLLSSPMLAFRTMQEYNAEGHNVTACVINYPSHSWEVFTNILLNSVGFLLPL
SVITFCTVQIMQVLRNNEMQKFKEIQTERKATLLVLAVLLLFVVCWLPFQISTFLDTLLR
LHVLSGCWDEYVIDIFTQIASFVAYSNSCLNPLVYVIVGKRFRKKSQEVYARLCRPGGCG
SAEPSQTENSMGTLRTSISVERNIHKLQ
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgttctcggcctggaggagaccaatgttcctatccatccatgaggacaccgtgcctacc
actgcctccttcggcgctgaaatgttcaacctcacctcccaggtccttgaacctgctctc
aacgggaccctgcccgagggcagcagctgcttccagtccgacttgtggaactggctcaac
accatccagccccccttcctctggatcctcttcctgctcgccgccctggagaacaccttt
gtcctcagcgtcttctgcctgcacaagagcagctgcacggtggcggagatctacctgggc
aacctggccgtggcagacctgatcctggcctgcgggctgcccttctgggccatcaccatt
gccaacaacttcgactggctcttcggggaagccctctgccgcgtggtgaacaccatactc
tacatgaacctctacagcagcatctacttcctcatgctggtgagcatcgaccgctacctg
gccctggtgaagaccatgtccatgggccggatgcgtggggtgcgctgggccaagctctac
agcctggtgatctggggctgcgcgctgcttctgagctcgcccatgctggccttccgcacc
atgcaggagtacaacgccgagggccacaacgtcaccgcctgcgtcatcaattacccatcc
cacagctgggaggtcttcaccaacatcctcctgaactctgtgggcttcctgctgcccctg
agcgtcatcaccttctgcaccgtgcagatcatgcaggtgctgcgtaacaacgagatgcag
aagttcaaggagatccagackgagaggaaggccacgctgctggtcctggccgtcctgctg
ctgttcgtggtctgctggctgcccttccagatcagcaccttcctggacacgctgctgcgc
ctccacgtcctctcsggctgctgggacgagtacgtgatcgacatcttcacacagatcgcg
tcctttgtggcttacagcaacagctgcctcaacccgctggtgtacgtgatcgtgggcaag
cgcttccgcaagaagtcgcaggaggtgtacgcgcggctgtgccggccagggggctgcggg
tccgcggagcccagccagacggagaactccatgggcacgctgcggacctccatctctgtg
gagcgcaacattcacaaactgcagtag

DBGET integrated database retrieval system