KEGG   Bos indicus (zebu cattle): 109575276Help
Entry
109575276         CDS       T04792                                 

Definition
(RefSeq) mast cell protease 2
  KO
K01329  chymase [EC:3.4.21.39]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    109575276
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:biu01002]
    109575276
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.39  chymase
     109575276
Peptidases [BR:biu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109575276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 109575276
NCBI-ProteinID: XP_019838829
Position
21
AA seq 247 aa AA seqDB search
MHHPPLPLLLLLLLCCRTQAGEIIEGTESKPHSRPYMAYLQIVTWDGKXKACGGFLIRRD
FVLTAAHCAGRSVTVTLGAHNLQKKEDTWQRLEVIKQFPYPKYEHVGLHDIMLLKLKEKA
NLTLAVGTIPLPSHFTFIHPGIMCRVAGWGQTAVNEPASSTLQEVKLRLMEPRACSHFSA
FNHNLQLCVGNPQSTKSAFKGDSGGPLLCAGVAQGIVSYGLPBAKPPAVFTRISPYRPWI
DEVLKEN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcatcatcctcctctccccctgctgctgctcctcctcctgtgttgcagaacccaggct
ggggagatcatcgagggcacagagagcaagccacactcccgcccctacatggcctacctg
caaattgtcacctgggatggtaagcwgaaggcttgtggtggtttcctgataagaagggac
tttgtgctgacggctgcgcactgtgcaggaaggtctgtaacagtcaccctcggagcccat
aacttacaaaagaaagaagacacatggcagaggcttgaagtcataaaacagtttccttac
ccaaaatatgagcatgttggtctccacgacatcatgttactgaagttgaaggagaaagcc
aacctgaccctggccgtggggacaatcccccttccatcccatttcacctttatccacccc
ggrataatgtgccgggtggccggctggggacaaacagctgtgaatgaaccagcctccagc
actctgcaagaggtgaagctgagactcatggagccccgggcctgcagccacttctctgct
tttaaccacaatctccagctgtgtgtgggcaatccccagagcacaaaatctgcatttaag
ggagactcggggggccctcttctgtgtgctggggtggcccagggcattgtctcctatgga
ctgcccratgcaaagcccccagccgtcttcacccggatctccccttaccggccctggatc
gatgaggtcctgaaagagaattaa

DBGET integrated database retrieval system