KEGG   Bos indicus (zebu cattle): 109575576
Entry
109575576         CDS       T04792                                 

Gene name
SERPINA1
Definition
(RefSeq) alpha-1-antitrypsin
  KO
K03984  alpha-1-antitrypsin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109575576 (SERPINA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109575576 (SERPINA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109575576 (SERPINA1)
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I4: serpin family
   109575576 (SERPINA1)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109575576 (SERPINA1)
SSDB
Motif
Pfam: Serpin DUF1266
Other DBs
NCBI-GeneID: 109575576
NCBI-ProteinID: XP_019839360
Position
21
AA seq 416 aa
MALSITRGLLLLAALCCLAPISLAGVLQGHAVQETDDTSHQEAACHKIAPNLANFAFSIY
HHLAHQSNTSNIFFSPVSIASAFAMLSLGAKGNTHTEILKGLGFNLTELAEAEIHKGFQH
LLHTLNQPNHQLQLTTGNGLFINESAKLVDTFLEDVKNLYHSEAFSINFRDAEEAKKKIN
DYVEKGSHGKIVELVKVLDPNTVFALVNYISFKGKWEKPFEMKHTTERDFHVDEQTTVKV
PMMNRLGMFDLHYCDKLASWVLLLDYVGNVTACFILPDLGKLQQLEDKLNNELLAKFLEK
KYASSANLHLPKLSISETYDLKSVLGDVGITEVFSDRADLSGITKEQPLKVSKALHKAAL
TIDEKGTEAVGSTFLEAIPMSLPPDVEFNRPFLCILYDRNTKSPLFVGKVVNPTQA
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggcactctccatcacgcggggccttctgctgctggcagccctgtgctgcytggccccc
atctccctggctggagttctccaaggacacgctgtccaagagacagatgatacatcccac
caggaagcagcgtgccacaagattgcccccaacctggccaactttgccttcagcatatac
caccatttggctcatcagtccaacaccagcaacatcttcttctcccccgtgagcatcgct
tcagcctttgcgatgctctccctgggagccaagggcaacactcacactgagatcctgaag
ggcctgggtttcaacctcactgagctcgcagaggctgagatccacaaaggctttcagcat
cttctccacaccctsaaccagccaaaccaccagctgcaactgaccactggcaatggtctg
ttcatcaatgagagtgcaaagctagtggatacgtttttggaggatgtcaagaacctgtat
cactccgaagccttctccatcaacttcagggatgctgaggaggccaagaagaagatcaac
gattatgtagagaagggaagccatggaaaaattgtggagttggtaaaggttcttgaccca
aacacagtttttgctctggtgaattacatttcctttaaaggaaaatgggagaagcccttc
gagatgaagcacaccacagagagggacttccatgtggacgagcaaaccactgtgaaggtg
cccatgatgaaccgcctgggcatgtttgacctccactactgcgacaagctcgccagctgg
gtgctgctgttggactacgtgggcaacgtcaccgcctgcttcatcctgcccgacctgggg
aaactgcagcagctggaggacaagctcaacaacgaactcctcgccaagttcctggaaaag
aaatatgcaagttctgccaatttacatttgcccaaactgtccatttctgaaacgtaygat
ctaaaaagtgtcctgggcgatgtgggcatcaccgaggtcttcagcgatagggctgacctc
tcagggatcaccaaggaacagcctctgaaggtgtccaaggctctccacaaggctgcactg
accatcgatgagaaagggacagaagctgtcgggtccacgtttctggaagccatccccatg
tcccttcccccagacgtcgagttcaacagacccttcctctgcatcctctacgacagaaac
accaaatctcccctcttcgtgggaaaggtggtgaatcccacccaagcctaa

DBGET integrated database retrieval system