KEGG   Bos indicus (zebu cattle): 109575581
Entry
109575581         CDS       T04792                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04064  NF-kappa B signaling pathway
biu04210  Apoptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04625  C-type lectin receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04668  TNF signaling pathway
biu04722  Neurotrophin signaling pathway
biu04920  Adipocytokine signaling pathway
biu04926  Relaxin signaling pathway
biu04931  Insulin resistance
biu05132  Salmonella infection
biu05134  Legionellosis
biu05135  Yersinia infection
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05215  Prostate cancer
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109575581 (NFKBIA)
   04668 TNF signaling pathway
    109575581 (NFKBIA)
   04024 cAMP signaling pathway
    109575581 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109575581 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109575581 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    109575581 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    109575581 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    109575581 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    109575581 (NFKBIA)
   04660 T cell receptor signaling pathway
    109575581 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    109575581 (NFKBIA)
   04659 Th17 cell differentiation
    109575581 (NFKBIA)
   04657 IL-17 signaling pathway
    109575581 (NFKBIA)
   04662 B cell receptor signaling pathway
    109575581 (NFKBIA)
   04062 Chemokine signaling pathway
    109575581 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109575581 (NFKBIA)
   04926 Relaxin signaling pathway
    109575581 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109575581 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109575581 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109575581 (NFKBIA)
   05203 Viral carcinogenesis
    109575581 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109575581 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    109575581 (NFKBIA)
   05215 Prostate cancer
    109575581 (NFKBIA)
   05222 Small cell lung cancer
    109575581 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109575581 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109575581 (NFKBIA)
   05135 Yersinia infection
    109575581 (NFKBIA)
   05134 Legionellosis
    109575581 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109575581 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    109575581 (NFKBIA)
   05162 Measles
    109575581 (NFKBIA)
   05164 Influenza A
    109575581 (NFKBIA)
   05161 Hepatitis B
    109575581 (NFKBIA)
   05160 Hepatitis C
    109575581 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    109575581 (NFKBIA)
   05163 Human cytomegalovirus infection
    109575581 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109575581 (NFKBIA)
   05169 Epstein-Barr virus infection
    109575581 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109575581 (NFKBIA)
   05140 Leishmaniasis
    109575581 (NFKBIA)
   05142 Chagas disease
    109575581 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109575581 (NFKBIA)
   04131 Membrane trafficking [BR:biu04131]
    109575581 (NFKBIA)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    109575581 (NFKBIA)
Membrane trafficking [BR:biu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109575581 (NFKBIA)
SSDB
Motif
Pfam: Ank_2 Ank Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 109575581
NCBI-ProteinID: XP_019839367
Position
21
AA seq 314 aa
MFQPAEPGQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLEAXCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSILQATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQTLPESEDEESYDTESEFTEDEL
PYDDCVLGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgttccagcctgccgagcccggccaagattgggccatggagggcccccgggacgcgctc
aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag
gagtatgagcagatggtgaaggagctgcgagagatccgcctcgagccgcaggaggcgccg
cgcggcgccgagccctggaaacagcagctcaccgaggacggagactcgttcctgcactta
gccatcatccatgaagagaaggcgctgaccatggaagtggtccgccaagtgaagggagac
ctggccttcctcaacttccagaacaacctgcagcagacgccactccacttggctgtgatc
actaaccagccagaaatcgctgaggcacttctggaagctgrctgtgatcctgagctgcga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg
ggagtcctgactcagccccgggggacccagcacctccactccatcctgcaggccaccaac
tacaatggccacacgtgtctgcacttggcctctattcatggctacctgggcatcgtggag
ctgttggtgtccttgggcgctgatgtcaacgctcaggagccctgcaatggccgaactgcc
ctccatctggcagtggacctgcagaatcccgacctggtgtcactcctattgaagtgtggg
gctgatgtcaacagagtcacctaccagggctactccccgtaccagctcacgtggggccgc
cccagcacccggatacagcagcagctgggccagctgaccctagagaaccttcagacactg
ccggagagcgaggatgaggagagctatgacaccgaatcagagttcacagaggacgagctt
ccctacgatgactgtgtgcttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system