KEGG   Bos indicus (zebu cattle): 109575594
Entry
109575594         CDS       T04792                                 

Gene name
SERPINA5
Definition
(RefSeq) plasma serine protease inhibitor
  KO
K03913  protein C inhibitor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109575594 (SERPINA5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109575594 (SERPINA5)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109575594 (SERPINA5)
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I4: serpin family
   109575594 (SERPINA5)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   109575594 (SERPINA5)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 109575594
NCBI-ProteinID: XP_019839385
Position
21
AA seq 404 aa
MRLCLFLCLVLLGPRMATLRRSQKKKIQEVPPAVTTAPPGSRDFVFDLYRALAAAAPAQN
IFFSPLSITVSLAMLSLGAQSNTKAQILEGLGIGPGEGSEEELHSASQRLLRELQQPQDS
LQLSLGNALFTKPRLPIQEAFLGAMRTLYLADTFPTNFEDPEGAKKKINDYVAKQTKGKI
VDLIKSLDGTQVMVMVNYIFFKAKWETSFNLKSTHEQDFYVTPETVVRVPMMKQQDQFYY
LLDRNLSCKVVGVPYQGNATAFFILPREGEMEQVENGLKEKTLKKWLRMPMKRRLELYLP
KFSIEGSYQLEEVLPKLGIRDIFTSDADLTGISNHSSIRVSEMVHKAVVEVDESGTQAAA
ATGMVITFKSARLGSQRIVFNRPFLVLIVKNSKHILFLGKVTRP
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgcgtctctgtctcttcctgtgcctggtgctcctcgggccgcggatggccaccctccgg
cgctcccaaaagaagaaaatccaggaggtgccgccagcggttaccacggcgccgccaggc
agcagggactttgtcttcgacctctacagggccttggccgcagccgcccccgctcagaac
atcttcttctcccctctgagcatcaccgtgagcctggccatgctctccctgggtgctcaa
tccaacacgaaggcgcagatcctggaaggcctgggcatcggcccgggggaaggctcggag
gaggagctccacagcgcctcccagaggctgctgcgcgagctccagcagccccaagacagc
ctccagctgagcctgggcaacgccctgttcaccaagcccaggttgcccatccaggaggcc
ttcctgggtgccatgaggactctgtacctggcagacactttccccacgaactttgaggac
cccgaaggggccaagaagaagatcaatgattacgtggcaaagcaaacgaaaggcaagatt
gtggacttgataaagagcctggatggcacccaggtcatggtcatggtgaattacattttc
tttaaagctaagtgggagacaagcttcaacctcaaaagcacccacgagcaggacttctac
gtgaccccagagacggtggtgcgggtccccatgatgaaacaacaggaccagttttactac
ctcctggaccgaaacctctcctgcaaggtggtgggggtcccctaccaagggaacgccact
gccttcttcattctcccccgcgagggggaaatggagcaggtggaaaatggcctgaaggaa
aaaacactcaagaagtggctcaggatgcccatgaagaggcggcttgagctttatcttccc
aagttctctattgagggctcctatcagctggaggaagtcctccccaagctggggatcaga
gacatcttcacctccgacgccgacctgaccggcatctccaaccactccagcatccgggtc
tctgagatggtgcacaaagctgtggtggaggtggatgagtctggaacccaagcggctgca
gccacggggatggtcatcacgttcaaatctgcccgattgggctctcaaaggatagtcttc
aacaggccttttctggtgctcattgtgaagaacagcaaacacatccttttcttaggcaaa
gtgactcgcccttga

DBGET integrated database retrieval system