KEGG   Bos indicus (zebu cattle): 109575716
Entry
109575716         CDS       T04792                                 

Definition
(RefSeq) mast cell protease 1A-like
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04210  Apoptosis
biu04650  Natural killer cell mediated cytotoxicity
biu04940  Type I diabetes mellitus
biu05202  Transcriptional misregulation in cancer
biu05320  Autoimmune thyroid disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109575716
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109575716
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    109575716
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109575716
   05330 Allograft rejection
    109575716
   05332 Graft-versus-host disease
    109575716
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109575716
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109575716
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     109575716
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109575716
SSDB
Motif
Pfam: Trypsin Trypsin_2 Phage_CII Glyco_transf_7C
Other DBs
NCBI-GeneID: 109575716
NCBI-ProteinID: XP_019839563
Position
21
AA seq 250 aa
MVLFLLLVALLSPTGEAGKIIGGHEAKPHSRPYMVFLQFKISGEPQRCGGFLVREDFVLT
AAHCLGSSINVTLGAHNIMDRERTQQFIPVRRPIPYPRYNKTWANDIMLLQLMRKANVTT
AVSPISLPRDWDTVNPGMLCSVAGWGRLDVDMSRTKKLQEVELEVQRAEKCTSRYKYYST
TTQICVGDPRKRKSSFKGDSGGPLVCNGVAQGIVSYGKKDGTPPRVFTRISSFLPWIQKT
MKQYELEGPD
NT seq 753 nt   +upstreamnt  +downstreamnt
atggtcctgttcttgctcctggtggcccttctgtcccctaccggggaggcagggaaaatc
atcgggggccacgaggccaagccacactcccgtccctacatggtgtttcttcagttcaag
atttcaggggaacctcaaagatgtgggggattccttgtgcgtgaggacttcgtgctgaca
gcagctcactgcctgggaagctcaatcaatgtcaccctgggggcccacaacatcatggac
agagagaggacccagcagttcatcccagtgagaagacccatcccctacccacgctataat
aagacttgggccaacgacatcatgttactgcagctgatgaggaaggcaaatgtgaccact
gctgtgagccccatcagtctgcccagggactgggatacagtgaatccagggatgctgtgc
agtgtggctggctgggggcgtcttgatgtggatatgtcccgcacaaagaaactacaggag
gtagagcttgaagtccaaagggccgagaaatgcacctctcgctacaaatattacagtacc
accacccagatatgtgtaggggacccgagaaagaggaagagttcctttaagggtgactcc
gggggcccacttgtgtgtaatggtgtggcccagggcattgtgtcctatggaaaaaaggat
gggacacctccaagggtcttcaccagaatctcaagctttctgccttggatccaaaaaaca
atgaaacagtacgaacttgagggaccagactga

DBGET integrated database retrieval system