KEGG   Bos indicus (zebu cattle): 109575725
Entry
109575725         CDS       T04792                                 

Gene name
TIGIT
Definition
(RefSeq) T-cell immunoreceptor with Ig and ITIM domains
  KO
K16350  T-cell immunoreceptor with Ig and ITIM domains
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109575725 (TIGIT)
SSDB
Motif
Pfam: V-set ig Ig_3 I-set Ig_2 HOK_GEF
Other DBs
NCBI-GeneID: 109575725
NCBI-ProteinID: XP_019839601
Position
1
AA seq 243 aa
MQWCLLLIWAQVLKQALLPTSGAVTGRIVTMGNISAEEGGSVTLQCHLSSTTAKVTQVNW
NLQDQVVAIHHDSLGWHINPAFKERVVPDSNLGLTLRWLTSNDTGQYTCVYHTYPDGIYK
GVLFLQVLRHSVAEYSAGFQIPLLGAMAAVLVVICIAVIAVATLARKKSLRIRSAEGDLG
RGPSEPEVCRPRVVSSPGSCVQADAGLCDDQGSEDHAEAEPHEYFNVLSYRSLASFSFPT
ETG
NT seq 732 nt   +upstreamnt  +downstreamnt
atgcagtggtgtctcctgctgatctgggcccaggtgctgaagcaggctctcctccccaca
tcaggagctgtgacaggcagaatagtaacaatggggaacatttctgcagaggaaggtggc
tctgtcaccttacaatgtcacctctcctccaccactgccaaagtgacccaagtcaactgg
aatctgcaagaccaagttgtggccattcatcatgacagcttggggtggcacatcaatcct
gccttcaaggagcgagtggtcccggactccaatttgggcctcaccctccggtggctgacc
agtaacgacacgggacagtacacctgcgtctatcacacctaccctgacgggatttacaaa
ggggtgctctttctgcaagtcctacgacactcagtggctgagtacagcgctgggttccag
atcccactgcttggagccatggccgcagtgctagtggtcatctgcatagcagtcattgca
gtggccacactggccagaaagaaatctctccgaatccgttctgcggaaggtgaccttggg
agggggccgtctgaaccggaggtgtgcaggcccagggtcgtgtcctcccccggcagctgt
gtgcaggcggatgccgggctgtgcgatgaccagggcagcgaggaccacgccgaggccgag
ccgcacgagtacttcaacgtcctgagctacagaagcctggccagcttcagcttccccacc
gagacgggttag

DBGET integrated database retrieval system