KEGG   Bos indicus (zebu cattle): 109575747
Entry
109575747         CDS       T04792                                 

Gene name
BCL2A1
Definition
(RefSeq) bcl-2-related protein A1
  KO
K02162  hematopoietic Bcl-2-related protein A1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04064  NF-kappa B signaling pathway
biu04210  Apoptosis
biu05202  Transcriptional misregulation in cancer
biu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109575747 (BCL2A1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109575747 (BCL2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    109575747 (BCL2A1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109575747 (BCL2A1)
SSDB
Motif
Pfam: Bcl-2 CCDC24 DUF4453
Other DBs
NCBI-GeneID: 109575747
NCBI-ProteinID: XP_019839594
Position
21
AA seq 175 aa
MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKFD
VVSVDTARTIFNQVMEKEFEDGIVNWGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISF
FVAEFITENTGEWIKQNGGWENGFVKKFETKSGWLTFLEVTGKICETLCRLKQYY
NT seq 528 nt   +upstreamnt  +downstreamnt
atgactgacactgagtttggctacgttcacgggctggctgaggactatctgaaatatgtg
ttgcagatacagcaacctggatccaagccaagcaaaacatccagggtgttacaagatgtg
gcttcctctgtccaggacgaagtggaaaggactctgaagcagtgcttggataagtttgat
gtggtgtccgtagacactgccagaacaatattcaaccaagtgatggaaaaggaatttgaa
gatggcattgttaactggggcaggattgtaaccatattcgcctttgaaggtattcttacc
aagaaacttctgggcaagtgtattgcctcagacatggacatgtgcaaggacatttctttc
tttgtggcggagttcatcaccgaaaatacaggagagtggataaagcaaaatggaggctgg
gaaaatgggtttgtaaagaagtttgaaaccaaatctggctggctgacttttctggaagtt
acaggaaagatctgtgaaacattatgtcgcctgaagcaatactattga

DBGET integrated database retrieval system