KEGG   Bos indicus (zebu cattle): 109576053
Entry
109576053         CDS       T04792                                 

Gene name
RAF1
Definition
(RefSeq) LOW QUALITY PROTEIN: RAF proto-oncogene serine/threonine-protein kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04068  FoxO signaling pathway
biu04071  Sphingolipid signaling pathway
biu04072  Phospholipase D signaling pathway
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04218  Cellular senescence
biu04270  Vascular smooth muscle contraction
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04371  Apelin signaling pathway
biu04510  Focal adhesion
biu04540  Gap junction
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04720  Long-term potentiation
biu04722  Neurotrophin signaling pathway
biu04726  Serotonergic synapse
biu04730  Long-term depression
biu04810  Regulation of actin cytoskeleton
biu04910  Insulin signaling pathway
biu04912  GnRH signaling pathway
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04917  Prolactin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04921  Oxytocin signaling pathway
biu04926  Relaxin signaling pathway
biu04928  Parathyroid hormone synthesis, secretion and action
biu04929  GnRH secretion
biu04935  Growth hormone synthesis, secretion and action
biu05010  Alzheimer disease
biu05034  Alcoholism
biu05132  Salmonella infection
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05219  Bladder cancer
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109576053 (RAF1)
   04012 ErbB signaling pathway
    109576053 (RAF1)
   04014 Ras signaling pathway
    109576053 (RAF1)
   04015 Rap1 signaling pathway
    109576053 (RAF1)
   04370 VEGF signaling pathway
    109576053 (RAF1)
   04371 Apelin signaling pathway
    109576053 (RAF1)
   04630 JAK-STAT signaling pathway
    109576053 (RAF1)
   04068 FoxO signaling pathway
    109576053 (RAF1)
   04072 Phospholipase D signaling pathway
    109576053 (RAF1)
   04071 Sphingolipid signaling pathway
    109576053 (RAF1)
   04024 cAMP signaling pathway
    109576053 (RAF1)
   04022 cGMP-PKG signaling pathway
    109576053 (RAF1)
   04151 PI3K-Akt signaling pathway
    109576053 (RAF1)
   04150 mTOR signaling pathway
    109576053 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109576053 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    109576053 (RAF1)
   04218 Cellular senescence
    109576053 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109576053 (RAF1)
   04540 Gap junction
    109576053 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    109576053 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109576053 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109576053 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    109576053 (RAF1)
   04660 T cell receptor signaling pathway
    109576053 (RAF1)
   04662 B cell receptor signaling pathway
    109576053 (RAF1)
   04664 Fc epsilon RI signaling pathway
    109576053 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    109576053 (RAF1)
   04062 Chemokine signaling pathway
    109576053 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109576053 (RAF1)
   04929 GnRH secretion
    109576053 (RAF1)
   04912 GnRH signaling pathway
    109576053 (RAF1)
   04915 Estrogen signaling pathway
    109576053 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    109576053 (RAF1)
   04917 Prolactin signaling pathway
    109576053 (RAF1)
   04921 Oxytocin signaling pathway
    109576053 (RAF1)
   04926 Relaxin signaling pathway
    109576053 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    109576053 (RAF1)
   04919 Thyroid hormone signaling pathway
    109576053 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    109576053 (RAF1)
   04916 Melanogenesis
    109576053 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109576053 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    109576053 (RAF1)
   04720 Long-term potentiation
    109576053 (RAF1)
   04730 Long-term depression
    109576053 (RAF1)
   04722 Neurotrophin signaling pathway
    109576053 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    109576053 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109576053 (RAF1)
   05206 MicroRNAs in cancer
    109576053 (RAF1)
   05205 Proteoglycans in cancer
    109576053 (RAF1)
   05230 Central carbon metabolism in cancer
    109576053 (RAF1)
   05231 Choline metabolism in cancer
    109576053 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109576053 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109576053 (RAF1)
   05212 Pancreatic cancer
    109576053 (RAF1)
   05225 Hepatocellular carcinoma
    109576053 (RAF1)
   05226 Gastric cancer
    109576053 (RAF1)
   05214 Glioma
    109576053 (RAF1)
   05221 Acute myeloid leukemia
    109576053 (RAF1)
   05220 Chronic myeloid leukemia
    109576053 (RAF1)
   05218 Melanoma
    109576053 (RAF1)
   05211 Renal cell carcinoma
    109576053 (RAF1)
   05219 Bladder cancer
    109576053 (RAF1)
   05215 Prostate cancer
    109576053 (RAF1)
   05213 Endometrial cancer
    109576053 (RAF1)
   05224 Breast cancer
    109576053 (RAF1)
   05223 Non-small cell lung cancer
    109576053 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109576053 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    109576053 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109576053 (RAF1)
   05152 Tuberculosis
    109576053 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109576053 (RAF1)
   05164 Influenza A
    109576053 (RAF1)
   05161 Hepatitis B
    109576053 (RAF1)
   05160 Hepatitis C
    109576053 (RAF1)
   05163 Human cytomegalovirus infection
    109576053 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109576053 (RAF1)
   05165 Human papillomavirus infection
    109576053 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109576053 (RAF1)
   01522 Endocrine resistance
    109576053 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109576053 (RAF1)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109576053 (RAF1)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   109576053 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 109576053
NCBI-ProteinID: XP_019839917
Position
22
AA seq 648 aa
MEHIQGAWKTISNGFGFKDTVFDGTSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTVGDGGVPALPSLTMRRMRESVSRIPPGSQHRYSTPHAFTF
SASSPSSEGSLSQRQRSTSTPNVHMVSATLPVDSRMIEDAIRSHSESGSPSALSSSPNNL
SPTGWSQPKTPAPAQRERAPGSSTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQXQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggcgcctggaagacgatcagcaacggtttcggattcaaagacacg
gtgtttgacggcaccagctgcatctcccctacaatagttcagcaatttggctatcagcgt
cgggcgtcagatgatggcaaacttacggacccttctaagacaagcaacactatccgtgtg
tttttgccmaacaagcaragaacagtggtcaatgtgcggaatggaatgagcttgcatgac
tgcctcatgaaagctctcaaggtgaggggcctgcaaccagagtgctgtgcagtgttcaga
cttctccacgaacacaagggtaaaaaagcacggttagattggaatactgatgctgcctcg
ttgatcggagaggaacttcaagtggatttcctggatcatgttcccctcacaacacacaac
tttgctcggaaaaccttcctgaagcttgccttctgtgacatctgtcagaagttcttgcta
aatggatttagatgtcagacttgtggctacaagtttcacgagcattgtagcaccaaagta
cccactatgtgtgtggactggagtaatatcagacagctcttattgttcccaaattccact
gttggtgatggcggggtcccagcgctgccttctttgacgatgcgtcggatgcgagagtct
gtttcccggatacctcctggttcccagcacagatattccacaccccatgctttcacattc
agcgcctccagcccctcctctgaaggctccctctcccagaggcagaggtcgacgtccacg
cccaacgtgcacatggtcagcgccaccctgcctgtggacagcaggatgatcgaggatgca
attcgaagtcacagtgaatcaggctccccttcagccttgtccagcagtcccaacaatttg
agcccaacaggctggtcacagcccaaaacccctgcgcctgcacagagagagcgggcgcca
ggctccagcacccaggagaagaacaaaattaggcctcgtggacagagagattcgagctat
tactgggaaatagaagccagtgaagtgatgctgtccactcggattggatcaggctccttt
gggactgtttataagggcaagtggcatggagacgttgcagtaaagattctgaaggtcgtt
gaccccaccccagagcagtsccaggccttcaggaatgaggtggctgtcctccgcaaaacc
cggcacgtgaacatcctgctcttcatggggtacatgacgaaggacaacctggcgatagtg
acccagtggtgcgagggcagcagcctctacaaacacctgcacgtccaggagaccaagttc
cagatgttccagctgattgacattgcccggcagacggctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaataatatatttctccatgaaggcctg
acggtgaaaatcggtgattttggattggccacggtgaagtcacgctggagtggttctcag
caggtcgagcagcccaccggctccatcctgtggatggccccagaggtgatccggatgcag
gataataacccgttcagcttccagtccgacgtctactcctacggcatcgtgctgtatgag
ctcatgacgggggagctcccttactcccacatcaacaaccgcgaccagatcatcttcatg
gtgggccgcgggtatgcctccccagacctcagcaagctatacaagaactgccccaaagcc
atgaagaggctggtagctgactgcgtgaagaaagtgaaggaagaaaggcctctttttccc
cagatcctgtcttccatcgagctgctccagcattctctgcccaagatcaaccggagtgcc
tcggagccctccctgcaccgggcggcccacaccgaggacatcaacgcctgcacgctgacc
acgtcccctcggctscctgtcttctag

DBGET integrated database retrieval system