KEGG   Bos indicus (zebu cattle): 109576149Help
Entry
109576149         CDS       T04792                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00561  Glycerolipid metabolism
biu01100  Metabolic pathways
biu04714  Thermogenesis
biu04723  Retrograde endocannabinoid signaling
biu04923  Regulation of lipolysis in adipocytes
Module
biu_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    109576149 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    109576149 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    109576149 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    109576149 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:biu01002]
    109576149 (MGLL)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109576149 (MGLL)
Peptidases [BR:biu01002]
 Serine Peptidases
  Family S33
   109576149 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_5 LIDHydrolase BAAT_C Abhydrolase_3 Thioesterase DUF1350 PGAP1
Motif
Other DBs
NCBI-GeneID: 109576149
NCBI-ProteinID: XP_019840142
Position
22
AA seq 313 aa AA seqDB search
MQTAPEDPFRMPEERPPRLTPQNVPYQDLPHLVNADGQHLFCRYWRPLSAPRALVFVSHG
AGEHCGRYDELAQMLVGLGLLVFAHDHVGHGQSEGERMVVSDFHVFIRDVLQHVDAVQKD
YPGLPVFLLGHSMGGAICILTAAERPGHFSGMVLISPLVVANPESATLFKVFAAKVLNLV
LPNMSLGRIDSSVLSRNKTEVDIYNTDPLVCRAGLKVCFGNQLLNAVSRVERALPKLTLP
FLLLQGSADRLCNSRGAYLLMESAKSQDKTLKIYEGAYHILHKELPEVTSSVFREINTWV
SQRTAVEGMGCPP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcagacagcacctgaagatcctttcagaatgccagaggaacgtccccccaggctgacc
ccgcagaacgttccctaccaggacctccctcacctggtcaacgctgacgggcagcacctc
ttctgccggtactggagacccttgagcgcgcccagggccctggtgttcgtgtcccacgga
gctggcgagcactgcggccgctacgacgagctggcgcagatgctggtrgggctgggcctg
ctggtcttcgcccacgaccatgtcggccaygggcagagcgagggcgagaggatggtggtg
tccgacttccacgtcttcatccgggatgtgctccagcacgtggacgccgtgcagaaggac
tacccggggctgcctgtcttcctcctcggccactccatgggcggcgcgatctgcatcctc
acggccgcggagaggccgggccacttctcgggcatggttctcatttccccgctggtcgtc
gccaatccagagtcggcgacacttttcaaggtcttcgctgcgaaagttctgaacctcgtc
ctgccaaacatgtccctgggccggatcgactccagtgtgctctcgaggaataagacggag
gtggacatctacaacacggaccccctggtctgccgggcgggactcaaagtctgctttggc
aaccagctgctcaacgcggtgtcgcgggtggagcgggcgctgcccaagctgacgctgccc
ttcctgctgctgcagggctctgccgaccgcctctgtaacagcaggggcgcctacctgctc
atggagtcagccaagagccaggacaagacgctcaagatttacgaaggtgcctatcacatc
ctccacaaagagcttcctgaggtgaccagctctgtcttccgggagataaacacgtgggtc
tcgcaaaggacagcggtggagggaatggggtgcccaccctga

DBGET integrated database retrieval system