KEGG   Bos indicus (zebu cattle): 109576217
Entry
109576217         CDS       T04792                                 

Gene name
ITGA9
Definition
(RefSeq) integrin alpha-9
  KO
K06585  integrin alpha 9
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04512  ECM-receptor interaction
biu04514  Cell adhesion molecules
biu04810  Regulation of actin cytoskeleton
biu05165  Human papillomavirus infection
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109576217 (ITGA9)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109576217 (ITGA9)
   04514 Cell adhesion molecules
    109576217 (ITGA9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109576217 (ITGA9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109576217 (ITGA9)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109576217 (ITGA9)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109576217 (ITGA9)
   05414 Dilated cardiomyopathy
    109576217 (ITGA9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109576217 (ITGA9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109576217 (ITGA9)
Cell adhesion molecules [BR:biu04515]
 Integrins
  Integrin alpha subunits
   109576217 (ITGA9)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 Integrin_alpha
Other DBs
NCBI-GeneID: 109576217
NCBI-ProteinID: XP_019840303
Position
22
AA seq 1035 aa
MGGSAAQRGAGGLRALLLALVAAGTPAGAYNLDPQRPVRFQGPAGSFFGYAVLEHFHDNT
RWVLVGAPKADSKYSTSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGMPCGKTCREDR
DDEWMGVSLARQPKADGRVLACAHRWKNIYYETDHILPHGFCYIIPSNLQAKGRTLIPCY
EEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWSGTVKVLNLTDNTYFKLNDEVIM
NRRYTYLGYAVTAGHFSHVSSTDVVGGAPQDEGIGKVYIFRADRRSGTLIKIFQASGKKM
GSYFGSSLCAVDLNTDGLSDLLVGAPMFSEIRDEGQVTVYINKGNGVLEEQLTLSGDGAY
NAHFGESIASLGDLDDDGFPDVAIGAPKEDDFSGAVYIYHGDARGMVPQYSMKLSGRKIS
PVLRMFGQSISGGIDMDGNSYPDVTVGAFMSDSVVLLRARPVITVDVSIFLPASINITAP
QCHDGQQPVNCLNVTACFSFHGKHVPGEIGLNYVLTADVAKKEKSQLPRVYLVLLGESVG
QVSEKLRLVHLEETCHHYVAHVKRRVQDVISPIVFEAAYSLGEHVTGEEEKELPALTPVL
RWKKGQKIAQKNQTVFERNCRSEDCAADLQLQGHLLLSSVDEKTPYLALGAVKNISLNIS
ISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLELDFLKCSVGFPFMRSKSKYE
FSVIFDTSHLSGEEEVLSFIITAQSGNVERSESLHNNVLTLTVPLMHEVDTSITGIMSPT
SFVYGESVDASNFIQLDDLECHFQPLNVTLQIYNTGPSTLPGSSVSMSFPNRLSPGGAEM
FHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKTGISCLT
MHCNLSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMTHAKVKVDPSLRVVEVASGNPE
EMTVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKN
RKENEDSWDWVQKNQ
NT seq 3108 nt   +upstreamnt  +downstreamnt
atgggcggctcggcggcgcagaggggcgccggggggctccgcgcgctgctcctggcgttg
gtggctgcagggacccctgcgggcgcctacaacctggacccgcagcgcccagtgcgcttc
caaggtcctgccgggtccttcttcggctacgcggtgctggagcacttccacgacaacacg
cgctgggtccttgtgggtgcaccaaaggcggattccaagtacagcacttcagtgaagtcc
cctggggctgtgtttaagtgccgagtccacaccaaccctgaccggagatgcaccgaactg
gacatggctcgagggaagaatcggggcatgccctgtggaaagacctgccgggaagaccga
gatgatgaatggatgggggtcagcctggcgcggcagcccaaggccgatggccgtgtgctg
gcctgtgcccaccgctggaagaacatytactatgaaacagaccacatcctgccccacggc
ttctgttacatcatcccgtccaacctccaggccaaaggcaggacrctgatcccttgctat
gaagagtacaagaagaagtacggagaggagcacggctcctgccaggccgggatagcgggc
ttcttcaccgaggagctggtggtgatgggtgccccaggctcattttattggtctgggaca
gtcaaagtgctgaacctcacggacaacacctatttcaaactgaatgatgaagtgatcatg
aacaggaggtacacctacctgggctatgcagttactgccggccacttttctcacgtgtcc
tccactgatgtggtaggaggtgccccgcaggatgaaggcatcgggaaggtttatattttt
agagctgaccgaagatcaggcaccttaattaagatttttcaagcttcaggtaaaaagatg
ggctcttacttcggctcctccttatgcgcagttgacctgaacactgacggcctctccgac
ctgttggtgggggcccccatgttttctgagatcagggacgaagggcaggtcaccgtctac
atcaacaaaggaaatggagtcctggaggagcagctgaccctgagcggagacggtgcctac
aatgcacactttggggagagcatcgccagcctgggcgacctggatgatgatgggttccca
gatgtggccattggcgcacctaaggaggatgacttttcgggagcagtgtacatctatcac
ggtgatgccagggggatggtccctcagtattccatgaagctgtcggggcggaagataagt
ccggtgctgcggatgtttggtcagtccatatcgggaggcattgacatggatggaaatagt
tatcctgatgtaactgttggagccttcatgtcggacagtgtggttctcctaagggcgaga
cccgtcatcacagtggatgtctccatcttcctccccgcctccatcaacatcacggcgcct
cagtgtcatgacggccagcagcctgtgaactgcctcaacgtcaccgcctgctttagcttc
cacggcaaacacgttccgggagaaataggcctgaattatgttctgacggctgatgtggcc
aaaaaagagaagagccagctgccccgggtctacttggtgttgctgggagagtccgtgggc
caggtctccgagaagctgcggctggtgcacttggaggagacgtgccatcactatgtggcc
cacgtgaagcggagagtacaggatgtcatcagccccatcgtgttcgaggccgcctacagc
ctgggcgagcatgtgacgggagaggaggagaaggagctgccagccctgacccccgtgctc
cgctggaaaaagggacaaaagattgcccagaagaatcagaccgtgtttgaaaggaattgc
cgatctgaggactgtgccgctgacctgcagctgcagggtcacctgttactctccagcgtt
gatgagaaaaccccgtatctagctctgggggctgtgaagaacatctccctaaacatctcc
atctccaacctcggggatgatgcctatgatgccaacgtgtcattcaacgtttctcgggag
ctcttcttcatcaacatgtggcagaaggaggaaatgggcatttcctgtgaactgctagaa
ttggacttcctcaaatgcagtgtgggatttcctttcatgaggtcaaagtcaaagtatgaa
ttcagcgtgatctttgatacaagccacctgtctggggaagaggaagttcttagcttcatc
attacagctcagagcggcaacgtggagcgctcagagtcccttcacaacaacgtcctcaca
ctgacggtgccactgatgcacgaagtggacacgtccatcacgggaatcatgtctccaacc
tcctttgtgtacggcgagtctgtggacgcatccaacttcattcaactggatgacctggag
tgtcatttccaacccctcaacgtcacccttcagatctataacactgggccaagcaccctt
cctgggtcatctgtcagcatgtccttccccaatcgactgtcacctggtggagcagagatg
tttcacgtgcaggagatggtggtgggccaagagaagggaaactgttctttccagaaaaac
ccaaccccctgcatcatccctcaagaacaagaaaatatcttccatacaatatttgctttt
ttcacaaagtcgggaagaaaagtcttggactgtgaaaaaacaggaatttcttgcctaaca
atgcactgtaaccttagtgcactcgctaaagaagaaagtcgtactatagacatttatatg
ctgctgaacacagaaatactgaagaaggacagttcatctgtcatccagttcatgacccac
gccaaggtgaaggtggacccttccctgagagtggtggaggtagccagtgggaacccggag
gagatgacggtggtcttcgaggcgttgcacaatctggagccgcgaggctacgtcgtgggg
tggatcattgccatcagtttgctggtgggaatcctcatcttcctgctcctggccgtgcta
ctctggaagatgggcttctttcgcagaaggtacaaagaaattattgaagctgagaagaac
cggaaagagaatgaagacagttgggactgggtccagaaaaaccagtga

DBGET integrated database retrieval system