KEGG   Bos indicus (zebu cattle): 109576336Help
Entry
109576336         CDS       T04792                                 

Gene name
OXTR
Definition
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04020  Calcium signaling pathway
biu04024  cAMP signaling pathway
biu04080  Neuroactive ligand-receptor interaction
biu04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109576336 (OXTR)
   04024 cAMP signaling pathway
    109576336 (OXTR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109576336 (OXTR)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109576336 (OXTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109576336 (OXTR)
G protein-coupled receptors [BR:biu04030]
 Rhodopsin family
  Peptide
   Oxytocin
    109576336 (OXTR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx Gaa1
Motif
Other DBs
NCBI-GeneID: 109576336
NCBI-ProteinID: XP_019840488
Position
22
AA seq 391 aa AA seqDB search
MEGAFAANWSAEAVNGSAAPPGTEGNRTAGPPQRNEALARVEVAVLCLILFLALSGNACV
LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLXLMSLDRCLAICQPLRSLSRRTDRLAVLVTWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLATCYGLISFKIWQNLRLKTAAAAA
EAAAGAEGEAADWAGRAILARVSNVKLISKAKIRTVKMTFIVVLAFIVCWTPFFFVQMWS
VWDADAPKEASPFIIAMLLASLNSCCNPWIYMLFTGHLFQELVQRFLCCSFRRLKGSRPG
ETSVSKKSNSSTFVLSQYSSSQRRCSQPSTL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggagggtgcgtttgcggctaactggagcgctgaggcggtcaacgggagcgcggcgccg
ccgggaaccgagggcaatcgcactgccgggccgccacagcgcaacgaggccctggcgcgg
gtggaggtggccgtgctgtgcctcatcctgttcctggcgctgagcggcaacgcgtgcgtg
ctgctagcgctgcgcaccacgcgccacaagcactcgcgcctcttcttcttcatgaagcac
ctgagcatagccgacctggtagtggcggtgttccaggtgctgccgcagcttctgtgggac
atcacgttccgcttctacgggcccgacctgctgtgccgcctcgtcaagtacctgcaggtt
gtgggcatgttcgcgtccacctacctgctgcygctcatgtcgctcgaccgctgcctggcc
atctgccagccgctgcgctcgctgagccgccgcaccgaccgcctggcggtactcgtcaca
tggctcggctgcctggtggccagcgcgccgcaggtgcacatcttctcgctgcgcgaggtg
gccgacggtgtcttcgactgctgggccgttttcattcaaccctgggggcccaaggcctac
atcacgtggatcacgctcgccgtctacattgtgcccgtcatcgtccttgccacctgctat
ggccttatcagcttcaagatctggcagaatttacggctcaagacggcggcggcggcggca
gaggctgccgcgggggctgagggcgaggcggcagactgggcggggcgcgcgattctggcc
cgcgtcagcaacgtcaagctcatctctaaggccaagatccgcacggtcaagatgaccttc
atcgtcgtgctggccttcatcgtgtgctggacgccattctttttcgtgcagatgtggagt
gtctgggatgccgatgcgcccaaggaagcctcacctttcatcatcgccatgctcctggcc
agcctcaacagctgctgcaacccctggatctacatgctcttcacgggccacctcttccaa
gaacttgtgcagcgcttcctctgctgctcattccgccgcctgaaaggcagccggcctggg
gagacaagcgtcagcaaaaagagcaactcgtctacctttgtcctgagccagtacagctcc
agccagagaagatgctcgcagccatccacgctgtga

DBGET integrated database retrieval system