KEGG   Bos indicus (zebu cattle): 109576356
Entry
109576356         CDS       T04792                                 

Gene name
MYD88
Definition
(RefSeq) myeloid differentiation primary response protein MyD88 isoform X1
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04064  NF-kappa B signaling pathway
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu05132  Salmonella infection
biu05133  Pertussis
biu05134  Legionellosis
biu05135  Yersinia infection
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05143  African trypanosomiasis
biu05144  Malaria
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05161  Hepatitis B
biu05162  Measles
biu05164  Influenza A
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109576356 (MYD88)
   04064 NF-kappa B signaling pathway
    109576356 (MYD88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109576356 (MYD88)
   04621 NOD-like receptor signaling pathway
    109576356 (MYD88)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109576356 (MYD88)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109576356 (MYD88)
   05135 Yersinia infection
    109576356 (MYD88)
   05133 Pertussis
    109576356 (MYD88)
   05134 Legionellosis
    109576356 (MYD88)
   05152 Tuberculosis
    109576356 (MYD88)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109576356 (MYD88)
   05162 Measles
    109576356 (MYD88)
   05164 Influenza A
    109576356 (MYD88)
   05161 Hepatitis B
    109576356 (MYD88)
   05168 Herpes simplex virus 1 infection
    109576356 (MYD88)
   05169 Epstein-Barr virus infection
    109576356 (MYD88)
  09174 Infectious disease: parasitic
   05144 Malaria
    109576356 (MYD88)
   05145 Toxoplasmosis
    109576356 (MYD88)
   05140 Leishmaniasis
    109576356 (MYD88)
   05142 Chagas disease
    109576356 (MYD88)
   05143 African trypanosomiasis
    109576356 (MYD88)
SSDB
Motif
Pfam: TIR Death TIR_2
Other DBs
NCBI-GeneID: 109576356
NCBI-ProteinID: XP_019840510
Position
22
AA seq 384 aa
MGGAQNTSKGGFRIPTSPAPPPRDLEGSDGGPPASAHLLGLQIVGQGGASRKERPAGRDQ
VGGAAEGEGGSTGPXRDSTARRLPRQPAMAEGVPRAGSALPAASLSSLPLAALNVRVRRR
LSLFLNVRAPVAADWTVLAEAMDFEYLEIQQLEKYADPTSRLLDDWQRRPGASVGRLLEL
LAKLGRDDVLMELGPSIEEDCQKYILKQQQEASEKPLQVDSIDSSITRINDMAGITIRDD
PLGQKPECFDAFICYCPSDIEFVHEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELI
EKRCRRMVVVVSDEYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKPMKKEFPSILRFIT
VCDYTNPCTQNWFWTRLAKALSMP
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgggtggagctcagaacacctcaaaaggcggattccggatccccacatccccagcaccc
ccgccccgagatctcgaaggcagtgatggggggccccccgcctccgcacatctactgggg
ctccagattgtagggcagggcggtgcttctcggaaagagagaccggcggggcgggaccag
gtgggcggggcggccgaaggggaaggaggaagcacaggcccasgacgcgactcgactgcg
cggcggctcccgcggcagcccgccatggctgaaggagtaccccgcgcggggtccgcgctc
cccgcggcttccttgtcctccctgcccctggcagcgctcaacgtacgagtgcggcgccgc
ctgtcgctcttcctaaaygtgcgggcgccggtggcggccgactggaccgtgctggcggag
gcgatggacttcgagtacttggagatccagcagctggagaagtacgccgaccccacgagc
aggctcctggacgactggcagcgacgtccgggagcctcagtgggccgcctgctcgagctg
ctcgccaagctcggccgcgacgacgtgctgatggaactgggacccagcatcgaggaggac
tgccaaaagtatattctgaagcagcagcaggaggcatctgagaagcctttacaggtggac
tctatagacagcagcataactcggataaatgacatggcaggcatcaccattcgcgacgac
cccctagggcaaaagcccgagtgttttgatgccttcatctgctactgccccagcgatatt
gagtttgtccacgagatgatccggcagctggaacagacaaactatcggctgaagttgtgc
gtgtctgaccgtgacgtcctgcctggcacctgtgtctggtccatcgccagtgaactcatt
gagaagaggtgccgtcggatggtggtggtggtctctgacgaatacctgcaaagcaaggaa
tgtgatttccagactaagtttgcactcagcctctctccaggtgcccatcagaagcgactg
atccccatcaagtacaagccaatgaagaaagagttccccagcatcctgcgcttcatcact
gtctgtgactacaccaacccctgcacccagaactggttctggactcgcctcgccaaggcc
ctgtccatgccctga

DBGET integrated database retrieval system