KEGG   Bos indicus (zebu cattle): 109576545
Entry
109576545         CDS       T04792                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04672  Intestinal immune network for IgA production
biu04940  Type I diabetes mellitus
biu05140  Leishmaniasis
biu05145  Toxoplasmosis
biu05150  Staphylococcus aureus infection
biu05152  Tuberculosis
biu05164  Influenza A
biu05166  Human T-cell leukemia virus 1 infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05322  Systemic lupus erythematosus
biu05323  Rheumatoid arthritis
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109576545
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109576545
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109576545
   04612 Antigen processing and presentation
    109576545
   04658 Th1 and Th2 cell differentiation
    109576545
   04659 Th17 cell differentiation
    109576545
   04672 Intestinal immune network for IgA production
    109576545
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109576545
   05322 Systemic lupus erythematosus
    109576545
   05323 Rheumatoid arthritis
    109576545
   05320 Autoimmune thyroid disease
    109576545
   05321 Inflammatory bowel disease
    109576545
   05330 Allograft rejection
    109576545
   05332 Graft-versus-host disease
    109576545
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109576545
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109576545
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109576545
   05152 Tuberculosis
    109576545
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109576545
   05164 Influenza A
    109576545
   05168 Herpes simplex virus 1 infection
    109576545
   05169 Epstein-Barr virus infection
    109576545
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109576545
   05140 Leishmaniasis
    109576545
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109576545
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109576545
  Exosomal proteins of epithelial cells
   109576545
  Exosomal proteins of breast milk
   109576545
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3
Other DBs
NCBI-GeneID: 109576545
NCBI-ProteinID: XP_019840738
Position
23
AA seq 277 aa
MVCLWFPPGSWTVILPVILMVLSPLLAWAGNTRTXFMVQGKSECHFSNGTQQVRFLDRYI
YNREEQVQFDSLVGEYRARTEMXXXXXERWNRWPQALQRARAAVHAFCASNYEFFASRTV
QRRVQPTVTVYPVKSRPLWHHNLLVCSVNGFYPGHIEVRWFRNGQEXEAGVVSTGLIPNG
DWTFQIMVMLEIVPQGGEVYACHVEHPSRMSPVTVEWRAQDKSSQEKXLSGIGACVLGLL
FLGMGLLFYIRRERFDLPGTVVVMTSEATDKMRKTEI
NT seq 834 nt   +upstreamnt  +downstreamnt
atggtgtgcctttggttccccccaggctcctggacagtaattctgccagtgatactgatg
gtgctgagccctctcctggcttgggctgggaacacccgaacaytcttcatggtgcagggc
aagtccgagtgtcacttctccaacggcacgcagcaggtgcgcttcctagacaggtacatc
tacaaccgcgaggagcaggtgcagttcgacagcctcgtgggcgagtaccgggcgcggacc
gagatggnnnnnnnnnnnnccgagcgctggaaccgctggccccaggccctgcagcgggcc
cgcgccgccgtgcacgccttctgcgccagcaactacgagttctttgcragccgcacggtg
cagaggagagttcagcctaccgtgactgtgtatcctgtaaagagtcggcccctatggcac
cacaacctcctggtctgctctgtgaatggtttctacccaggccacattgaggtcaggtgg
ttccggaatggccaggaaraggaggccggsgtggtctccacaggcctgatacctaatgga
gactggaccttccagatcatggtgatgcttgaaatagttcctcagggtggagaggtctat
gcctgccacgtggagcaccccagccgtatgagccctgtcacagtggaatggagggcacag
gacaaatcttcacaagaaaagwtgctgagtggaatcggggcctgtgttctgggtctgctc
ttccttgggatggggctgctcttctacatcaggagagagagatttgatctcccaggaaca
gtggtggtgatgacaagcgaggcgacagacaaaatgagaaagactgagatctga

KEGG   Bos indicus (zebu cattle): 109576596
Entry
109576596         CDS       T04792                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain-like isoform X1
  KO
K06752  MHC class II antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04672  Intestinal immune network for IgA production
biu04940  Type I diabetes mellitus
biu05140  Leishmaniasis
biu05145  Toxoplasmosis
biu05150  Staphylococcus aureus infection
biu05152  Tuberculosis
biu05164  Influenza A
biu05166  Human T-cell leukemia virus 1 infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05322  Systemic lupus erythematosus
biu05323  Rheumatoid arthritis
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109576596
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109576596
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109576596
   04612 Antigen processing and presentation
    109576596
   04658 Th1 and Th2 cell differentiation
    109576596
   04659 Th17 cell differentiation
    109576596
   04672 Intestinal immune network for IgA production
    109576596
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109576596
   05322 Systemic lupus erythematosus
    109576596
   05323 Rheumatoid arthritis
    109576596
   05320 Autoimmune thyroid disease
    109576596
   05321 Inflammatory bowel disease
    109576596
   05330 Allograft rejection
    109576596
   05332 Graft-versus-host disease
    109576596
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109576596
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109576596
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109576596
   05152 Tuberculosis
    109576596
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109576596
   05164 Influenza A
    109576596
   05168 Herpes simplex virus 1 infection
    109576596
   05169 Epstein-Barr virus infection
    109576596
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109576596
   05140 Leishmaniasis
    109576596
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109576596
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109576596
  Exosomal proteins of epithelial cells
   109576596
  Exosomal proteins of breast milk
   109576596
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2
Other DBs
NCBI-GeneID: 109576596
NCBI-ProteinID: XP_019840797
Position
23
AA seq 278 aa
MVLRGRLVLGLHTLMTLLSLQEVGAIKADHMGSYGPAFYQSYDGAGQFTYDFDGEQLFSV
DLKKREAVWRLPEFGNFAYFDPQSGLVSIAMIKAHLEDLVKRSNGTRAPNVSPRVAVLPK
SRVQLGEPNVLICIVDKIFPPVINITWLRNGHPVTQGVTQSSFYAQPDHLFRKFHYLTFV
PLADDFYDCKVEHWGLDQPLFQHWEPQVPTALPDTTGTLVCALGLVLGLGGFLGGITLII
TGTCLSSTPRCSGGLGEEGDGPSERSKCETPFSFLASF
NT seq 837 nt   +upstreamnt  +downstreamnt
atggtcctcagggggaggctggtcctgggactgcacaccttgatgaccctcctgagcctc
caggaagttggggccatcaaggctgaccacatgggctcctatggaccagccttctaccag
tcctatgatggtgcaggtcagttcacgtatgattttgatggagaacagctgttttctgtg
gatctgaagaagagggaggctgtgtggcgtctgcctgaatttggcaacttcgcctacttt
gacccgcagagcgggctggtcagtatcgcaatgatcaaagcgcatctggaggacttggtg
aagcgctccaacggcaccagagcccccaacgtgtcccccagagtggccgtgctgcccaag
tctcgcgtgcagctgggcgagcccaatgtcctcatctgcatcgtggacaaaatcttcccc
ccggtcatcaacatcacctggctgcgcaacggccatcccgtcacccagggcgtgacccag
agcagcttctatgcgcagcctgaccacttgttccggaagttccactacctgacctttgtg
cccttggcggacgacttctacgactgcaaggtggagcactggggcctggaccagccgctc
tttcagcactgggagccccaggtgcccaccgcgctgcctgacaccacagggactctggtc
tgtgccctcggcctggtccttggcttagggggcttcctcgggggcatcaccctcatcatc
acgggcacgtgcctgtccagcacccccaggtgctcygggggtctgggggaggaaggtgat
ggcccttctgagagaagcaagtgtgagacaccattcagcttcctggcaagtttctga

KEGG   Bos indicus (zebu cattle): 109576666
Entry
109576666         CDS       T04792                                 

Definition
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04672  Intestinal immune network for IgA production
biu04940  Type I diabetes mellitus
biu05140  Leishmaniasis
biu05145  Toxoplasmosis
biu05150  Staphylococcus aureus infection
biu05152  Tuberculosis
biu05164  Influenza A
biu05166  Human T-cell leukemia virus 1 infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05322  Systemic lupus erythematosus
biu05323  Rheumatoid arthritis
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109576666
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109576666
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109576666
   04612 Antigen processing and presentation
    109576666
   04658 Th1 and Th2 cell differentiation
    109576666
   04659 Th17 cell differentiation
    109576666
   04672 Intestinal immune network for IgA production
    109576666
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109576666
   05322 Systemic lupus erythematosus
    109576666
   05323 Rheumatoid arthritis
    109576666
   05320 Autoimmune thyroid disease
    109576666
   05321 Inflammatory bowel disease
    109576666
   05330 Allograft rejection
    109576666
   05332 Graft-versus-host disease
    109576666
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109576666
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109576666
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109576666
   05152 Tuberculosis
    109576666
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109576666
   05164 Influenza A
    109576666
   05168 Herpes simplex virus 1 infection
    109576666
   05169 Epstein-Barr virus infection
    109576666
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109576666
   05140 Leishmaniasis
    109576666
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109576666
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109576666
  Exosomal proteins of epithelial cells
   109576666
  Exosomal proteins of breast milk
   109576666
SSDB
Motif
Pfam: C1-set DUF202
Other DBs
NCBI-GeneID: 109576666
NCBI-ProteinID: XP_019840878
Position
23
AA seq 256 aa
QKKVEPTVTVYPAKTQPLQXXNLLVCSVNGFYLGHVEVRWFWKGQEEEAGVISTGLIQNG
DWTFETIVMLETVLQSGEVYTCQXEHPSWRSPIAXEWRAQSDSAQSKMMSGTGGFALGLL
FLVVGLFTHFRNQKGHSGLQPTGIRTDLGLGLLMSVTKAFEPPQSNGLLVTLSVIIRVTH
FTVKLRGYEITFEEVFSAVHPIVHVPVSQSTMRSPMYYCIRVPVNTCKTLERTQLIRGTT
DNYQKENTQRLKYASN
NT seq 771 nt   +upstreamnt  +downstreamnt
cagaaaaaggtggagcctacagtgactgtatatcctgcaaagacccagcccctgcagcnn
nnnaacctcctggtctgctctgtgaatggtttctatctgggccatgttgaagtcaggtgg
ttctggaaaggccaggaagaggaggctggggtgatctccacaggcctgatccagaatgga
gactggactttcgagaccattgtgatgcttgaaacagttcttcagagtggagaggtctac
acctgccaastggagcaccccagctggagaagccctatmgcagwggaatggagggcacag
tctgactctgctcagagtaagatgatgagtggaactgggggctttgctctgggtctgctc
ttccttgtggtggggctgttcacccacttcaggaatcagaaaggacactctggacttcag
ccaacaggtattagaactgacttgggtttaggcttgcttatgtcggttaccaaggcattt
gagccacctcagtctaatggcctccttgtcacrctctcagtcatcattagggtaactcat
ttcactgtgaaattaagaggttacgaaatcacatttgaagaagttttttctgctgttcat
cctattgttcatgttcctgtttctcaaagcacaatgagatctccgatgtattactgcatt
agagttcccgtgaatacctgtaagacccttgagagaacacagctcatcagggggacaact
gataactatcagaaggaaaatacccagagactgaaatatgcatctaattag

KEGG   Bos indicus (zebu cattle): 109576780
Entry
109576780         CDS       T04792                                 

Definition
(RefSeq) SLA class II histocompatibility antigen, DQ haplotype D alpha chain-like
  KO
K06752  MHC class II antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04672  Intestinal immune network for IgA production
biu04940  Type I diabetes mellitus
biu05140  Leishmaniasis
biu05145  Toxoplasmosis
biu05150  Staphylococcus aureus infection
biu05152  Tuberculosis
biu05164  Influenza A
biu05166  Human T-cell leukemia virus 1 infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05322  Systemic lupus erythematosus
biu05323  Rheumatoid arthritis
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109576780
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109576780
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109576780
   04612 Antigen processing and presentation
    109576780
   04658 Th1 and Th2 cell differentiation
    109576780
   04659 Th17 cell differentiation
    109576780
   04672 Intestinal immune network for IgA production
    109576780
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109576780
   05322 Systemic lupus erythematosus
    109576780
   05323 Rheumatoid arthritis
    109576780
   05320 Autoimmune thyroid disease
    109576780
   05321 Inflammatory bowel disease
    109576780
   05330 Allograft rejection
    109576780
   05332 Graft-versus-host disease
    109576780
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109576780
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109576780
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109576780
   05152 Tuberculosis
    109576780
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109576780
   05164 Influenza A
    109576780
   05168 Herpes simplex virus 1 infection
    109576780
   05169 Epstein-Barr virus infection
    109576780
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109576780
   05140 Leishmaniasis
    109576780
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109576780
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109576780
  Exosomal proteins of epithelial cells
   109576780
  Exosomal proteins of breast milk
   109576780
SSDB
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3
Other DBs
NCBI-GeneID: 109576780
NCBI-ProteinID: XP_019840965
Position
23
AA seq 253 aa
MKKALILRALTLATMMSPYGGEDIVADHVGTYGTNVYQTYGASGQFTFEFDGDELFYVDL
GKKETVWRLPEFSNITKFEVQSALRNIVMSKRNLDILIKNSSFTPATSEIPEVAVFPKSS
VVLGIPNTLICQVDNIFPPVINITWFYNGHFVAEGIAETTFYPXSDHSFLKFSYLTFLPS
SEDFYDCRVEHWGLEEPLVKHWEPEIPTPTSELTETVVCALGLAMGLMGIVVGTVLILRV
RCLGAASRRRRAM
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaagaaagctctgattctgagggctctcactctggccaccatgatgagcccctatgga
ggtgaagacatcgtggctgaccacgtgggcacttacggcacaaatgtctaccagacgtac
ggcgcctctggccagttcacgtttgaatttgatggagacgagctcttctacgtggacctg
gggaaaaaggagactgtctggcggctgcccgagtttagcaatatcaccaaatttgaagtt
cagagcgccctgagaaacattgttatgtcaaaaagaaatttggacatcttgataaaaaat
tccagctttacacctgccaccagtgaaatccctgaagtggctgtgtttcccaaatcctcc
gtggtcctggggattcccaataccctcatctgtcaagtggacaacatctttcctcctgtg
atcaacatcacttggttttacaacggacactttgttgcagaagggatcgctgagaccacc
ttctaccccmagagtgaccactctttcctcaagttcagttacctcacctttcttccctcc
agtgaagacttctatgactgcagagtggagcactggggcctggaagagcccctcgtcaag
cactgggagcctgagattccaacccctacatcagagctgacagagactgtggtctgtgcc
ctggggctggccatgggcctcatgggcatcgtggtgggcactgtcctcatcctccgagtc
cggtgcttgggtgctgcctccagacgtcgaagggccatgtga

KEGG   Bos indicus (zebu cattle): 109577038
Entry
109577038         CDS       T04792                                 

Definition
(RefSeq) SLA class II histocompatibility antigen, DQ haplotype D alpha chain-like
  KO
K06752  MHC class II antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04672  Intestinal immune network for IgA production
biu04940  Type I diabetes mellitus
biu05140  Leishmaniasis
biu05145  Toxoplasmosis
biu05150  Staphylococcus aureus infection
biu05152  Tuberculosis
biu05164  Influenza A
biu05166  Human T-cell leukemia virus 1 infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05322  Systemic lupus erythematosus
biu05323  Rheumatoid arthritis
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577038
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109577038
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109577038
   04612 Antigen processing and presentation
    109577038
   04658 Th1 and Th2 cell differentiation
    109577038
   04659 Th17 cell differentiation
    109577038
   04672 Intestinal immune network for IgA production
    109577038
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109577038
   05322 Systemic lupus erythematosus
    109577038
   05323 Rheumatoid arthritis
    109577038
   05320 Autoimmune thyroid disease
    109577038
   05321 Inflammatory bowel disease
    109577038
   05330 Allograft rejection
    109577038
   05332 Graft-versus-host disease
    109577038
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109577038
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109577038
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109577038
   05152 Tuberculosis
    109577038
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577038
   05164 Influenza A
    109577038
   05168 Herpes simplex virus 1 infection
    109577038
   05169 Epstein-Barr virus infection
    109577038
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109577038
   05140 Leishmaniasis
    109577038
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109577038
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109577038
  Exosomal proteins of epithelial cells
   109577038
  Exosomal proteins of breast milk
   109577038
SSDB
Motif
Pfam: MHC_II_alpha
Other DBs
NCBI-GeneID: 109577038
NCBI-ProteinID: XP_019841327
Position
23
AA seq 133 aa
MILNRALIXGALALTTMMSPSGSEDIVADHIGAYGINVYHSYGPSGYYTHEFDGDEEFYV
DLEKRETVWNLPLFNKFXXFDPQGALRNIATAKHNLEIMIQESNSTTATNSMCSPLCLSL
LIYPSYQASLPFP
NT seq 402 nt   +upstreamnt  +downstreamnt
atgatcctgaacagagccctgatttkgggggccctcgccctgaccaccatgatgagtccc
tctgggagtgaagacattgtggctgaccacattggcgcctatggcataaacgtctaccac
tcatatggtccctctggctactatacccatgaatttgatggagatgaagagttctacgtg
gacctggaaaagagggagactgtctggaatctgcctctgtttaataaatttannnnnttt
gaccctcagggtgcgctgagaaacatagctacagcgaagcacaatttggagattatgatt
caagagtccaactctactactgctaccaacagtatgtgttccccactctgcctctcttta
ttaatctacccttcataccaggcctcactcccttttccctag

KEGG   Bos indicus (zebu cattle): 109577039
Entry
109577039         CDS       T04792                                 

Definition
(RefSeq) SLA class II histocompatibility antigen, DQ haplotype D alpha chain
  KO
K06752  MHC class II antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04672  Intestinal immune network for IgA production
biu04940  Type I diabetes mellitus
biu05140  Leishmaniasis
biu05145  Toxoplasmosis
biu05150  Staphylococcus aureus infection
biu05152  Tuberculosis
biu05164  Influenza A
biu05166  Human T-cell leukemia virus 1 infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05322  Systemic lupus erythematosus
biu05323  Rheumatoid arthritis
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577039
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109577039
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109577039
   04612 Antigen processing and presentation
    109577039
   04658 Th1 and Th2 cell differentiation
    109577039
   04659 Th17 cell differentiation
    109577039
   04672 Intestinal immune network for IgA production
    109577039
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109577039
   05322 Systemic lupus erythematosus
    109577039
   05323 Rheumatoid arthritis
    109577039
   05320 Autoimmune thyroid disease
    109577039
   05321 Inflammatory bowel disease
    109577039
   05330 Allograft rejection
    109577039
   05332 Graft-versus-host disease
    109577039
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109577039
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109577039
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109577039
   05152 Tuberculosis
    109577039
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577039
   05164 Influenza A
    109577039
   05168 Herpes simplex virus 1 infection
    109577039
   05169 Epstein-Barr virus infection
    109577039
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109577039
   05140 Leishmaniasis
    109577039
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109577039
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109577039
  Exosomal proteins of epithelial cells
   109577039
  Exosomal proteins of breast milk
   109577039
SSDB
Motif
Pfam: C1-set Ig_3 Ig_2 Marek_A I-set SKG6 C2-set_2
Other DBs
NCBI-GeneID: 109577039
NCBI-ProteinID: XP_019841328
Position
23
AA seq 132 aa
MLGQPNTLICHVDNIFPPVINITWLRNGHSVTEGVSETSFLIKSDYSFLKIKYLTFLPSD
NDIYDCKVEHWGLDEPLLKHWEPEVPAPMSELTETVVCALGLTVGLVGIVVGTIFIIQGL
RSGGASRHQGPL
NT seq 399 nt   +upstreamnt  +downstreamnt
atgctgggtcagcccaacaccctcatctgtcacgtggacaacatctttccccctgtgatc
aacatcacatggttgagaaacgggcactcggtcacagagggagtttctgagaccagtttt
ctcatcaagagtgattattctttcctcaagatcaaatatctcaccttcctcccttctgat
aatgacatttatgactgtaaagtggagcactggggcctggatgagccacttctgaaacac
tgggagcctgaggttccagcccctatgtcagagctgacagagactgtggtctgtgccctg
gggttgaccgtgggccttgtgggcattgtggtgggcaccatcttcatcatccaaggcctg
cgctcaggtggggcctccagacaccagggtcccttgtga

KEGG   Bos indicus (zebu cattle): 109577041
Entry
109577041         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: DLA class II histocompatibility antigen, DR-1 beta chain-like
  KO
K06752  MHC class II antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04672  Intestinal immune network for IgA production
biu04940  Type I diabetes mellitus
biu05140  Leishmaniasis
biu05145  Toxoplasmosis
biu05150  Staphylococcus aureus infection
biu05152  Tuberculosis
biu05164  Influenza A
biu05166  Human T-cell leukemia virus 1 infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05322  Systemic lupus erythematosus
biu05323  Rheumatoid arthritis
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577041
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109577041
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109577041
   04612 Antigen processing and presentation
    109577041
   04658 Th1 and Th2 cell differentiation
    109577041
   04659 Th17 cell differentiation
    109577041
   04672 Intestinal immune network for IgA production
    109577041
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109577041
   05322 Systemic lupus erythematosus
    109577041
   05323 Rheumatoid arthritis
    109577041
   05320 Autoimmune thyroid disease
    109577041
   05321 Inflammatory bowel disease
    109577041
   05330 Allograft rejection
    109577041
   05332 Graft-versus-host disease
    109577041
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109577041
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109577041
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109577041
   05152 Tuberculosis
    109577041
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577041
   05164 Influenza A
    109577041
   05168 Herpes simplex virus 1 infection
    109577041
   05169 Epstein-Barr virus infection
    109577041
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109577041
   05140 Leishmaniasis
    109577041
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109577041
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109577041
  Exosomal proteins of epithelial cells
   109577041
  Exosomal proteins of breast milk
   109577041
SSDB
Motif
Pfam: MHC_II_beta C1-set MHC_I Ig_2
Other DBs
NCBI-GeneID: 109577041
NCBI-ProteinID: XP_019841330
Position
23
AA seq 263 aa
MMCLWFXWMAALAVLLMVLSLPFSWARETQPHFIHQFKGECRFSNGLEXMRFFARYIYNT
QEDVHFDSDVGEFTALTELGRLDAEYWNQQKDFMEQMRAKVDTLCRSNYQGIGSFLRQRR
VEPTVTVYPAKTQPLQHHNLLVCSVNGFYPGHIEVRWFWNSHEEEAGVISTGLIQNGDWT
FQTMVMLETVPQSGEVYTCQVEHPSXXSPLTVEWRAQSDSAQRKLMSGIGGFVLGLLFLG
VGLFIHLRSKKGHPALQPIGPLS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgatgtgtctgtggttcnactggatggcagctttggcagtgctactgatggtgctcagc
cttcccttctcttgggccagggaaacccaaccgcatttcatccatcagtttaagggtgag
tgtcgtttctccaacggrttggagcrgatgcggttctttgccagatacatctacaacacg
caggaggatgtgcatttygacagcgatgtgggggagttcacggccctgacggagctgggg
aggctggacgccgagtactggaaccagcaaaaggacttcatggagcagatgcgggccaag
gtggacacrttgtgcagatccaactaccagggcattggtagcttcctgaggcagcgccga
gtggagcctacagtgactgtgtatcctgcaaagacccagcccctgcagcaccacaacctc
ctggtctgctctgtgaacggtttctacccaggccacattgaagtcaggtggttctggaac
agccatgaagaggaggctggggtgatctccacaggcctgatccagaatggagactggacc
ttccagaccatggtgatgcttgaaacagttcctcagagtggagaggtctacacctgccaa
gtggagcaccccagcyggaygagccctctcacagtggaatggagagcacagtctgactct
gctcagaggaagctgatgagtggaatcggaggctttgttctgggtctgctcttccttggc
gtgggrctgttcatccacctcaggagtaagaaaggacaccctgcacttcagcctatagga
cccctgagctga

KEGG   Bos indicus (zebu cattle): 109577042
Entry
109577042         CDS       T04792                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain
  KO
K06752  MHC class II antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04672  Intestinal immune network for IgA production
biu04940  Type I diabetes mellitus
biu05140  Leishmaniasis
biu05145  Toxoplasmosis
biu05150  Staphylococcus aureus infection
biu05152  Tuberculosis
biu05164  Influenza A
biu05166  Human T-cell leukemia virus 1 infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05322  Systemic lupus erythematosus
biu05323  Rheumatoid arthritis
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577042
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109577042
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109577042
   04612 Antigen processing and presentation
    109577042
   04658 Th1 and Th2 cell differentiation
    109577042
   04659 Th17 cell differentiation
    109577042
   04672 Intestinal immune network for IgA production
    109577042
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109577042
   05322 Systemic lupus erythematosus
    109577042
   05323 Rheumatoid arthritis
    109577042
   05320 Autoimmune thyroid disease
    109577042
   05321 Inflammatory bowel disease
    109577042
   05330 Allograft rejection
    109577042
   05332 Graft-versus-host disease
    109577042
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109577042
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109577042
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109577042
   05152 Tuberculosis
    109577042
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577042
   05164 Influenza A
    109577042
   05168 Herpes simplex virus 1 infection
    109577042
   05169 Epstein-Barr virus infection
    109577042
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109577042
   05140 Leishmaniasis
    109577042
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109577042
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109577042
  Exosomal proteins of epithelial cells
   109577042
  Exosomal proteins of breast milk
   109577042
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A Ig_2
Other DBs
NCBI-GeneID: 109577042
NCBI-ProteinID: XP_019841331
Position
23
AA seq 253 aa
MAITRVPILGLFITVLIGLQESWAIKENHVIIQAEFYLKPEESAEFMFDFDGDEIFHVDM
GKKETVWRLPEFGHFASFEAQGALANMAVMKANLDIMIKRSNNTPNTNVPPEVTLLPNKP
VELGEPNTLICFIDKFSPPVISVTWLRNGKPVTDGVSQTVFLPRNDHLFRKFHYLPFLPT
TEDVYDCKVEHLGLNEPLLKHWEYEAPAPLPETTENXVCALGLIVALVGIIAGTIFIIKG
VRKANTVERRGPL
NT seq 762 nt   +upstreamnt  +downstreamnt
atggccataaccagggtcccaatattaggacttttcatcactgtcctgatcggcctacag
gaatcgtgggctattaaagagaatcatgtgatcatccaagctgagttctatctgaaacct
gaggaatcagccgagtttatgtttgactttgatggtgatgagattttccacgtggatatg
gggaagaaggagacggtgtggcggcttccagaatttggacattttgccagctttgaggct
cagggtgccctggccaatatggctgtgatgaaagcyaacctggacatcatgataaagcgc
tccaacaacaccccaaacaccaatgttcctccagaagtgactctgctcccaaacaagcct
gtggaactgggagagcccaacacactcatctgcttcattgacaagttctccccacccgtg
atcagtgtcacatggcttcgaaatggcaaacctgtcactgatggagtgtcacagacggtc
ttcctgcccaggaatgaccaccttttccgcaagttccactacctccccttcctgcccaca
acagaggatgtctatgactgcaaggtggagcacttgggtttgaatgagcctcttctcaag
cactgggagtatgaagctccagcccccctcccagagaccacagagaatrcagtgtgtgcc
ctgggcctgattgtggctctggtgggcatcattgcagggaccatcttcatcatcaagggc
gtgcgcaaagccaacaccgttgaacgccgagggcctctgtga

KEGG   Bos indicus (zebu cattle): 109577307
Entry
109577307         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class II histocompatibility antigen, DM alpha chain
  KO
K06752  MHC class II antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04672  Intestinal immune network for IgA production
biu04940  Type I diabetes mellitus
biu05140  Leishmaniasis
biu05145  Toxoplasmosis
biu05150  Staphylococcus aureus infection
biu05152  Tuberculosis
biu05164  Influenza A
biu05166  Human T-cell leukemia virus 1 infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05322  Systemic lupus erythematosus
biu05323  Rheumatoid arthritis
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577307
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109577307
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109577307
   04612 Antigen processing and presentation
    109577307
   04658 Th1 and Th2 cell differentiation
    109577307
   04659 Th17 cell differentiation
    109577307
   04672 Intestinal immune network for IgA production
    109577307
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109577307
   05322 Systemic lupus erythematosus
    109577307
   05323 Rheumatoid arthritis
    109577307
   05320 Autoimmune thyroid disease
    109577307
   05321 Inflammatory bowel disease
    109577307
   05330 Allograft rejection
    109577307
   05332 Graft-versus-host disease
    109577307
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109577307
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109577307
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109577307
   05152 Tuberculosis
    109577307
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577307
   05164 Influenza A
    109577307
   05168 Herpes simplex virus 1 infection
    109577307
   05169 Epstein-Barr virus infection
    109577307
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109577307
   05140 Leishmaniasis
    109577307
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109577307
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109577307
  Exosomal proteins of epithelial cells
   109577307
  Exosomal proteins of breast milk
   109577307
SSDB
Motif
Pfam: MHC_II_alpha C1-set SKG6
Other DBs
NCBI-GeneID: 109577307
NCBI-ProteinID: XP_019841756
Position
23
AA seq 297 aa
MPRAVEGSELEKHDLGRNLGTWVSWLVVPSPPGRCEDMDHELSQEDALLRLLSFLWLLPL
SWTAPEAPAPGWRDELQNHTFLHTMYCQDWSPNVALSESYDEDQLFSFDFSQSIRVPRLP
EFADWAHQHGDTSDIMFDKGFCRAMIEEIGXELEGQIPVSRGFPIVQVFTLKPLEFGKPN
TLVCFISNLFPPTLTVNWQHQSAPVEGAGPTFVSAVDGLTFQAFSYLNVTPAPSDXFSCI
VTHEIDGYTAIAFWVPQNALPSDLLENVLCGVAFGLGVLGIIVGLVLFYCRKPCLGG
NT seq 894 nt   +upstreamnt  +downstreamnt
atgccaagggcagtggagggaagtgagctggagaaacatgatctgggaaggaatttgggg
acctgggtcagctggctggtagttcctagcccaccggggaggtgtgaagatatggatcat
gagctgagccaggaagatgcgctgctacggctgctctcctttctgtggctgctgcccctg
tcctggaccgcccctgaagctcctgctccagggtggagggatgagctacaaaaccacacg
ttcctgcacacaatgtactgccaggactggagccccaacgtggcgctctctgagtcctac
gacgaggaccagcttttctccttcgacttttcccagagcatccgagtgcctcgcttgcct
gaatttgctgactgggctcaccagcacggagatacttctgacattatgtttgacaaaggt
ttttgccgggccatgatcgaggaaattggcycagaacttgaagggcaaatcccagtgtct
agagggttccccatcgttcaggtgttcacactgaagcccctggagtttggcaagcccaac
acgctggtctgtttcatcagtaatctctttccacccacactgaccgtgaactggcagcat
cagtcggcacctgtggaaggagccgggcccacttttgtctccgcggttgatggactcacc
ttccaggccttttcctacttaaacgtcacaccagcaccctctgatnctttctcttgcatc
gtgactcatgagatcgatggctacacagcaatcgctttttgggtgccccagaacgcgctg
ccctctgatcttctggagaatgtgctgtgcggcgtggcctttggcctgggtgtgctgggc
atcattgttggcttggtcctcttctactgccgaaagccgtgcttagggggctga

KEGG   Bos indicus (zebu cattle): 109577316
Entry
109577316         CDS       T04792                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM beta chain isoform X1
  KO
K06752  MHC class II antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04672  Intestinal immune network for IgA production
biu04940  Type I diabetes mellitus
biu05140  Leishmaniasis
biu05145  Toxoplasmosis
biu05150  Staphylococcus aureus infection
biu05152  Tuberculosis
biu05164  Influenza A
biu05166  Human T-cell leukemia virus 1 infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05322  Systemic lupus erythematosus
biu05323  Rheumatoid arthritis
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577316
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109577316
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109577316
   04612 Antigen processing and presentation
    109577316
   04658 Th1 and Th2 cell differentiation
    109577316
   04659 Th17 cell differentiation
    109577316
   04672 Intestinal immune network for IgA production
    109577316
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109577316
   05322 Systemic lupus erythematosus
    109577316
   05323 Rheumatoid arthritis
    109577316
   05320 Autoimmune thyroid disease
    109577316
   05321 Inflammatory bowel disease
    109577316
   05330 Allograft rejection
    109577316
   05332 Graft-versus-host disease
    109577316
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109577316
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109577316
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109577316
   05152 Tuberculosis
    109577316
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577316
   05164 Influenza A
    109577316
   05168 Herpes simplex virus 1 infection
    109577316
   05169 Epstein-Barr virus infection
    109577316
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109577316
   05140 Leishmaniasis
    109577316
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109577316
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109577316
  Exosomal proteins of epithelial cells
   109577316
  Exosomal proteins of breast milk
   109577316
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 ig
Other DBs
NCBI-GeneID: 109577316
NCBI-ProteinID: XP_019841768
Position
23
AA seq 304 aa
MTVLLSLLLGFSLGCTAAGGFVAHVESTCVLDDDGDPKDFSYCISFNKDLLTCWDPLQAS
MIPREFGVLNGLARYLSQFLNNNSYLIQRLSNGLQNCAAHTQPFWSSLTHRTRPPTVQVA
KTTPFNTRESVMLACYVWGFYPADVAITWRRNGQEVLPHGRAWRIIQPNGDWTYQTVSHL
ATTPSFGDTYTCVVEHIGAPELILQDWSLIPGRGIETPTCCSSVADSNNNNKAESYCNSW
AVACADGEGFCGSGNAGPGSHHLRFRSAQLAESHLLRLHFPPGVHLSRRSAQLIEAEPYS
FPST
NT seq 915 nt   +upstreamnt  +downstreamnt
atgactgtcctcctgtcgctgctgctgggcttcagcctgggctgcaccgcagcaggtggt
tttgtggcacacgtggaaagcacctgtgtgttggacgatgatggggatccgaaagacttc
tcgtattgcatctccttcaacaaggatttgctgacctgctgggatcccctgcaggccagt
atgattcctcgtgaatttggggtgctgaacggcttggcccggtacctctcacagttcctc
aacaataatagttacctgatccagcgcttgtccaatggtctgcagaactgtgccgcgcac
acccagcccttctggagctctctgacccacaggacacgcccaccgaccgtgcaggtagcc
aaaaccactccttttaacacgagggagtctgtgatgctggcctgctatgtgtggggcttc
tatccagcggacgtggccatcacgtggaggaggaacgggcaggaggtcctcccacacggc
agggcctggaggatcatccagcccaacggagactggacataccagaccgtctcccatctg
gccacaaccccctcttttggggatacctacacctgtgtggtcgagcacattggggctcct
gaactcatccttcaggactggagtttgatccctggtcggggaattgagacccccacatgt
tgctctagcgtggctgacagtaacaacaacaacaaagcagagagctactgcaactcctgg
gctgttgcctgcgcagacggtgaaggtttctgtggctctggtaacgctggtcctgggtct
catcatcttcgttttcggtctgcacagttggcggagagccacctcctccggctacatttt
cctcccggggtccacttatccagaaggtcagcacaattgatagaggcagaaccctacagc
tttccctccacgtga

DBGET integrated database retrieval system