KEGG   Bos indicus (zebu cattle): 109576585
Entry
109576585         CDS       T04792                                 

Gene name
DAXX
Definition
(RefSeq) death domain-associated protein 6
  KO
K02308  death-associated protein 6
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04210  Apoptosis
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109576585 (DAXX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109576585 (DAXX)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109576585 (DAXX)
   05014 Amyotrophic lateral sclerosis
    109576585 (DAXX)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109576585 (DAXX)
SSDB
Motif
Pfam: Daxx Nop14 SDA1
Other DBs
NCBI-GeneID: 109576585
NCBI-ProteinID: XP_019840779
Position
23
AA seq 748 aa
MATANSIIVLDDDEEDEAAAQPGPSHPPPNPASPKAEAPGSSQPXGAGGSSSSGGKKCYK
LENEKLFEEFLALCKTQTADHPEVVPFLYNRQQRAHPLFLASAEFCNILSRVLSRAQNRP
AKLYVYINELCTVLKAHSAKKKLNLAPAATTSSEPSGNNPPTDPSSDPNAETTASEAPRT
HGSRRQIQRLEQLLALYVAEIRRLQEKELDLSEMDDPDSTYLQEARLKRKLIRLFGRLCE
LKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHS
LGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGIDPALSDPVLARRL
RENRSLAMSRLDEVISKYAMMQDRNEESERQKRRARLPQATSSHSEDTPKSSLDSGEGPS
GMASQECPTTSKAEIDDEEDEESEEEEEEEEEEDEEEDEEEDEEDEEEEDEATDSEEEED
LEQMKEGQGDDEEEEEEAEKDGDKSPMSPLPISTEKNLEPHKGKNGSSEEQQNKRLTESP
SSLAEEPPAPSSVVAESREEHLEELPLEEESPMSQLFELEIEALPLDTTPSPEERDVSSS
KKSEDLLXTVLENGAAMVTSTSFNGGVSPHTWGDSSPPRKKSRKEKQTEAGPLGKSHVEM
QRAVQKNGQKTHTLPSPPSPLASMAPVADSSTRVDSPSHGLVTSSLCSPLPTRLSHTPQS
QPSRPGTYKMSVATQCDPEEIIVLSDSD
NT seq 2247 nt   +upstreamnt  +downstreamnt
atggccaccgctaacagcatcatcgtgctggatgatgatgaagaagatgaagcagctgct
caaccagggccctcccacccaccccctaatccggcctcacccaaggcagaagcccctggc
tcctctcagccccrtggggctggaggaagcagtagttctggcggcaagaaatgctacaag
ttggagaatgagaagctgtttgaagagttccttgcactgtgtaagacgcagacggcggat
caccctgaggtggtcccgttcctctataaccggcagcagcgggcccaccctctgtttttg
gcctcggcggagttctgcaacatcctctctcgggtcctctctcgggcccagaaccggcca
gctaagctctatgtctacattaatgagctctgcacggttctcaaggcccactcagccaag
aagaagctgaacctggcccctgctgccaccacctctagtgagccctctgggaataaccct
cccacagacccctcctcggacccaaatgctgagaccactgcctctgaggccccaaggacc
catggttcccggcggcagatccagcgcttggagcagctgctggcactgtatgtggcagag
atccggcggctgcaagaaaaggagttggatctctcagaaatggatgacccagactccact
tacctgcaggaagcaaggttgaagcgtaagctgatccgtctctttggacggctgtgtgag
ctgaaagactgctcttcactgacaggccgggtcatagagcagcgcatcccctaccgtggt
acccgctacccagaggtcaataggcgcattgagmggctcatcaacaagccagggcctgat
accttccctgactatggagatgtactgcgcgccgtagagaaggcagctgctcggcacagc
cttggcctcccccgacagcagctccagctcatggctcaggatgccttccgagatgtgggc
atcaggttacaggagcgtcgccacctggatctcatctacaactttggctgtcacctcaca
gatgactataggccaggcattgatcccgcactgtcagatcctgtcctggcccggcgcctg
cgggagaaccgaagcttggctatgagccggctggatgaggtcatctccaagtatgcgatg
atgcaagacaggaatgaggagagtgagagacagaagagaagagcccggctcccccaggcc
acctcttcccactctgaagatacccccaaatcctcgttggattctggtgagggccctagt
gggatggcatcccaggagtgtcctaccacttccaaggctgagatcgatgatgaagaagat
gaggaaagtgaagaggaggaggaagaggaagaggaggaagatgaggaggaagacgaggag
gaagacgaggaagatgaggaggaagaagatgaggccacagattccgaagaagaggaggat
ctggaacagatgaaggaaggtcagggggacgatgaagaggaggaggaggaagcagagaag
gatggagataagagccccatgtccccactaccgatctccactgaaaagaacctggaacct
cataaagggaaaaatgggtcttcagaggagcagcaaaacaaaagactcacagagtcacca
tcttcactggcagaagagcccccggccccctccagtgtagttgctgaaagcagggaagag
cacctcgaggagctgcccctggaggaagagagccctatgtctcagctctttgagctagag
attgaagccttgcccctggatacgaccccttcccctgaggagagggacgtttcctcttcc
aagaaatcagaggacctcctcamcactgtgttggagaatggggccgccatggtcacctcc
acttccttcaatggaggcgtctctcctcacacttggggggattccagtcccccccgcaag
aaatctcggaaagagaagcaaacagaagctgggccattaggaaagagccatgtggaaatg
caaagggcagtacagaagaacgggcagaagacacataccctgcccagcccaccttccccc
ttggcttctatggctccagttgctgattcctcaacaagggtggactctcctagccatggc
ttggtgaccagctccctctgtagcccacttccaacccggttgtcccacactccccagtca
caaccctccaggcctggtacttataagatgagtgtggcgacacagtgtgatcccgaggag
atcatcgtgctctcagactctgattaa

DBGET integrated database retrieval system