KEGG   Bos indicus (zebu cattle): 109576672
Entry
109576672         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: complement C4-A-like
  KO
K03989  complement component 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05133  Pertussis
biu05150  Staphylococcus aureus infection
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109576672
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109576672
  09171 Infectious disease: bacterial
   05133 Pertussis
    109576672
   05150 Staphylococcus aureus infection
    109576672
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109576672
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109576672
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   109576672
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   109576672
  Exosomal proteins of other cancer cells
   109576672
SSDB
Motif
Pfam: TED_complement A2M A2M_BRD A2M_recep MG3 MG4 MG2 Big_1 ANATO SQHop_cyclase_C
Other DBs
NCBI-GeneID: 109576672
NCBI-ProteinID: XP_019840884
Position
23
AA seq 1595 aa
MRLLWGLIWASCFFALSLQKPRLLLFSPSVVRIGVPXSXAVKLQDAPSGQMVRGSVFLRN
PSHVNELCSPKVDFSLSSDRDFILLNVPIPQEQARVCRLHLLRRAPEVQLMVQSSWLRDS
LSKQTDMQGVNLLFSSRRGHLFLQTDQPVYNPGQPVRYRVFALDQKMRPATDIPMVMVEN
SQGFHVXKREVFXPSSIFQDNFVILDISEPAMXKISARFSDSLDSNSSTQXKVKKYVLPN
FEVKIIPENPYILTXPGFLSDIQVIIQARYIYGKPVQGVAYVRFGLLGEDGEKTFLRGLE
SQTKLVDGQCQISLQKAEFQGVLEKLNISTDDLPGLRLYVAAAVIESPGGEMEEAELTSW
RFVSSPFSLDLSKTKQQLIPGIPFLLQALVRDMSGSPASGIPVKVSAKLFSGSTSKNRDF
EQNTDGSGQVIVSIGVPRTISEVQLSVSAGSPYPAVGSLTVKAXVSRSSGFLSIEWQNPR
PLKVGETLNLNLPAVGISGSFSYFYYMIVSRDQIVSVHREPRSHLTSISMFVDHHLVPSF
HLVAFYYHGGVPVANSLRVDVQAGGCEGKLELNVDSSKAYRPGDTVKLNLKTESRALVAL
GAVDTALYAVGGKSHKPLDMVKVFEAMNSYDLGCGPGGGDTAPQVFKAAGLAFSDGDHRT
EIRKSLSCPKESKSRKKRNVNFQKAIHEKLGQYTSPVAKRCCQDGLTRLPMARTCEHVAG
ALAGAPGGSGRPPPHHPPPCAPEAMELLQEEDLIEEDDIPVRSFFPENWLWKVEEVDRFS
QLRLLLLDSLTMWEIHGVSLSKTTGLCVATPARLRVFHEFHMHLRLPVSVRRFEQLELRP
VLYNYLDSDLTVSVHVSPVEGLCLAGGGGLAXXXXVPAGSARPVGFSVVPIAAAAVSLKV
MARGSFDFPVGDTISKILQVEREGALHREEIVYELNPLDPRGWTLEIPGNSDPNIIPEGD
FKSFVRVTASDPLEGLGSEGALSPGGLSSLLRLPQGCAEQTMTLLAPTLAASXYLDKTEQ
WSMLXPETKDHAVNJIQKGYTWIQEFRKRDGSYGAWLHWDSSTWLTAFVLKILSLAQDQV
GGSAKKLQETATWLLSQQRDDGSFHDPCPVIHREMQGGLVGSDETVALTALVVIALHHRL
AVLPDKHSEHLSRVENSFSRVNTFLGAKVTSGLLGSHASAITAYTLLLTEALEDLRRVAH
NNLMAMAKDIGDKLYWGSVTTSPSNVLSPTPAPRSPADPIPQAPALWIETTAYGLLHLLL
WEGKAELADQAASWLTRQGSFQGGFRSTQDTVVALDALSAYWIASHTAEEKGLNVTLSSL
GRSGLKSHVLQLTNHQVHRLEEELQFSLGSKINVEVRGNSKGTLKVLCNYNVMDMTNTTR
QALQIEVTVMGHVEYTIEAEEDYEDXKXEDXPAGDDPEAHSRPMTPLNLFDRWRNYCKTE
AAKAANELEPRVHPVNQAGGPRQQARVSTGKSAKVGLSGMAIADITLLSGFHALRADLET
LASLSDRYVSHFETEGPHVLLYFDSVPTSQEYIGFGAVQEVPVGLVPPARAILCDYNNPE
HKSSVFYGAPRKSELFSMLCXAAFCQCGGRETPHR
NT seq 4788 nt   +upstreamnt  +downstreamnt
atgaggctcctctgggggctgatctgggcatcttgcttcttcgccttgtctctgcagaag
cccaggttgctcctgttttctccttctgtggttcgcataggggtccccncgtctrtggcc
gtgaaactccaggatgctccttcaggacagatggtgagaggatccgtgttcctgaggaac
ccatcccatgttaatgagctctgctccccgaaggtggatttcagcctcagctcagacaga
gacttcatactcctcaacgtcccgatcccccaggaacaggccagggtctgtcgcctccat
ctgctccgcagagcccccgaggtgcagctgatggtgcagtcctcatggctaagggactct
ctgtccaaacagacagacatgcagggtgtcaacctgttgttctcctctcgccgggggcac
ctctttctgcagacggaccagcccgtttataaccctggccagccggttcgctaccgagtc
tttgctctggatcagaagatgcgcccggccactgacatccccatggtcatggtggagaac
tctcaaggcttccaygtgtagaaaagggaagtgtttkctccctcctccatctttcaggac
aactttgtgatcctagacatatcagagccagcgatgtgaaaaatctcagcccgattctca
gacagcctggattccaatagcagcacccagnntaaggtgaagaaatatgttctccccaac
tttgaggtgaagatcattcctgaaaacccctacatcctgacaayrcctggctttcttagt
gacatccaagtgatcatccaggccaggtacatctacgggaagccagtgcagggggtggca
tacgtgcgctttgggctcctgggtgaggacggtgaaaagactttcctgcggggcctggag
agtcagaccaagctggtggatggccagtgccaaatttccctgcaaaaggctgagtttcag
ggtgtgctggagaagcttaatattagcactgatgacctcccagggctgcgcctgtatgtt
gcagcagccgttattgagtctccaggaggagagatggaggaggcagagctcacgtcctgg
cgtttcgtgtcatctcccttctccctggatctaagcaaaaccaagcagcagcttatacct
gggatccccttcctgctgcaggccctggtccgtgacatgtcaggctccccagcctctggc
attcccgtcaaagtgtctgccaagttgttttctggatcgacttctaaaaaccgggacttt
gaacagaacacagatgggagcggccaagtcattgtctccattggtgttcctcggaccatc
tcagaagtgcagctctcggtgtctgcaggctccccctaccctgcggtaggcagtctcact
gtgaaagcgcysgtgtccagaagctctggatttttgtccattgagtggcagaatccgcga
cctcttaaagtcggagagacccttaacctaaacctgccagccgtgggcatcagtgggagc
ttctcctacttctactacatgattgtgtcccgggaccagatcgtgtctgtacatcgagag
cccaggagccacctgacctccatctccatgtttgtggaccatcacctggtgccctccttc
cacctcgtggccttctactatcacgggggcgtcccggtggccaactccctgcgagtggac
gtccaggctggaggctgtgaggggaagctggagctgaacgtggacagttccaaggcgtat
cgtcctggggacactgtgaaactcaacctgaaaacagagtctcgagccctggtggccctg
ggagctgtggacacggctctgtatgctgtgggtggcaagtcccacaaacccctcgacatg
gtcaaggtcttcgaagctatgaacagctatgaccttggctgtggtcccggcggtggagac
actgcccctcaagtgttcaaagcagctggtctggccttttctgatggagaccatcggact
gaaatcagaaagagtctgagctgtcccaaggagtcaaagtctaggaaaaagagaaatgtg
aacttccaaaaggcgattcatgagaagctgggccagtacacttcccccgtcgccaagcgc
tgctgccaggacgggctgacgcggctgcccatggcgcgcacctgtgagcatgtggccggg
gcactggccggggcccctggagggtcaggacggccccctcctcaccaccctccaccgtgt
gcccccgaagccatggagctcctgcaggaggaggacctgatcgaagaggatgacatcccc
gtgcgcagcttcttccccgagaactggctttggaaagtggaagaagtggaccgcttctcc
caattgcgactgctgctcctggactctctgaccatgtgggagatccacggcgtgagcctg
tccaaaaccacaggcttgtgtgtggccaccccggcccgactccgagtgttccatgaattc
cacatgcacctccgcctgccggtctctgtccgccgctttgagcagctcgagctgcggcct
gtcctctacaactacctggatagcgatctgaccgtgagcgtccacgtgtccccagtggag
gggctgtgcctggccgggggtggagggctcgcccnnnnnnnnnaggtgcccgcgggctct
gcccggcccgttggcttctctgtggtgcccatcgcagctgctgccgtgtccctgaaggtg
atggctcgaggatcctttgatttccctgtgggggacacaatatctaagattctacaagtc
gagagagaaggggcccttcacagggaggaaatagtctatgaactcaaccccctggacccc
cgaggctggaccttggaaattcctggcaactctgatcccaatattatccctgaaggagat
ttcaagagtttcgtcagagtcacagcctcggatccactggaagggttgggctctgagggg
gccttgtcaccgggaggcctgtcctccctcctgaggcttccccaaggctgcgcggaacaa
accatgaccctgttggctccaacactggctgcttcccrctacctggacaagactgagcag
tggagcatgctgncccctgagaccaaggaccacgctgtgaatmtcatccagaaaggctac
acgtggatccaggagtttcgaaaaagagatggttcctacggggcttggttacattgggac
agtagcacctggctcacggcctttgtgctgaagatactgagtttggcccaggatcaggtg
ggcggctctgctaaaaagctgcaggagacggccacgtggctgctgtcgcagcaacgggat
gatggctcattccatgacccctgtcctgttatccacagggaaatgcagggaggcttagtg
ggaagcgatgagactgtggcgctcacggcccttgtggtcatygcccttcaccacaggctg
gcggtcctcccagacaagcattctgagcacttgagtagagtggaaaattccttctcaaga
gtaaacaccttcttgggtgcgaaagtaacctctgggctcctgggctcccacgcctccgcc
atcacggcctataccctgttgctgaccgaggccctcgaggacctgcggagagttgcccac
aacaacctcatggccatggccaaggacatcggtgataagctgtactggggctcagtcacc
acttctccaagcaacgtcctatcacccactccggctccacgtagcccagcagaccccatt
ccccaggctccrgccctstggattgaaaccacggcctacggcctgctacacctgctgcta
tgggagggcaaggctgagttggccgaccaggctgcatcctggctgacccgccagggcagc
ttccaagggggattccgcagcacccaggacactgttgtggctctggacgccctgtctgcg
tactggattgcgtcccacaccgccgaggagaaggggctcaacgtgaccctgagctccttg
ggccgcagtgggctcaagtcccacgtgttgcagctgaccaaccaccaagtccacaggctg
gaggaggagctgcagttttccctgggaagcaagattaacgtggaggtgagaggaaacagc
aaaggaaccttgaaggtcctttgcaactacaatgtcatggacatgacgaacacgacccgc
caggctcttcagattgaagtgacggtcatgggccacgtcgagtacacgatagaggcggag
gaggactacgaggacntaaagtaggaggactstccagccggggatgaccccgaggcccac
tcccggcccatgacacctctaaatctgtttgacaggtggaggaactactgtaagacagag
gctgccaaggcggccaacgaactggaacccagggtgcatccagtgaaccaggcaggggga
cccagacaacaggcacgtgtctccacaggcaagtctgcgaaggtggggctgtcaggcatg
gccattgcggacatcaccctcctgagtggattccacgccctgcgggctgacctggagacg
ctggcctccctctccgaccgttacgtgagccactttgagaccgagggtccccacgtcctg
ctgtacttcgactcggtccccacctcccaggagtacataggctttggagctgtgcaggag
gtgcccgtggggctggtaccgccggccagggccatcctgtgtgactacaacaaccctgag
cacaaaagctctgtgttttatggggcaccacgtaaaagcgaactcttctccatgttgtgc
ntagcagccttctgccagtgtggtgggcgtgagacccctcaccgttga

KEGG   Bos indicus (zebu cattle): 109576941
Entry
109576941         CDS       T04792                                 

Definition
(RefSeq) complement C4-like
  KO
K03989  complement component 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05133  Pertussis
biu05150  Staphylococcus aureus infection
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109576941
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109576941
  09171 Infectious disease: bacterial
   05133 Pertussis
    109576941
   05150 Staphylococcus aureus infection
    109576941
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109576941
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109576941
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   109576941
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   109576941
  Exosomal proteins of other cancer cells
   109576941
SSDB
Motif
Pfam: TED_complement A2M A2M_recep A2M_BRD NTR MG2 MG3 ANATO MG4 Big_1 Kelch_1
Other DBs
NCBI-GeneID: 109576941
NCBI-ProteinID: XP_019841150
Position
23
AA seq 1742 aa
MRLLWGLIWASCFFALSLQKPRLLLFSPSVVRIGVPLSVAVKLQDAPSGQVVRGSVFLRN
PSHVNELCSPKVDFSLSSDRDFILLNVPIPQEQARVCRLHLLRRAPEVQLMVQSSWLRDS
LSKQTDMQGVNLLFSSRRGHLFLQTDQPVYNPGQQVRYRVFALDQKMRPATDILTVTVEN
SQGFRVRKREVFAPSSIFQDNFLIPDISAPGTWKISARFSDSLDSNSSTQFEVKKYVLPN
FEVKIIPENPYILTTPGFLSDIQVIIQARYIYGKPVQGVAYVRFGLLGEDGEKTFLRGLE
SQTKLVDGQCQISLQKAEFQGVLEKLNISTDDLPGLRLYVAAAVIESPGGEMEEAELTSW
RFVLSPFSLDLSKTKQQLIPGVPFLLQALVRDMSGSPASGIPVKVSAKLFSGSTSKNRDF
EQNTDGSGQVIVSIGVPRTISEVQLSVSAGSPYPAVGSLTVKAPLSRSSGFLSIEWQNPR
PLKVGETLNLNLRAVGISGSFSYFYYMIVSRGQIVSVHREPRSHLTSISVFVDHHLVPSX
HLVAFYYHGGVPVANSLRVDVQAGGCEGKLELNVDSSKAYRPGDTVKLNLKTESRALVAL
GAVDTALYAVGGKSHKPLDMVKVFEAMNSYDLGCGPGGGDTAPQVFKAAGLAFSDGDHRT
EIRKSLSCPKESKSRKKRNVNFQKAIHEKLGQYTSPVAKRCCQDGLTRLPMTRTCEQRVA
RVQQPACREPFLSCCQFAESLRKKARTRGQVGLARAMELLQEEDLIEEDDIPVRSFFPEN
WLWKVEEVDRFSQLRLLLPDSLTTWEIHGVSLSKTTGLCVATPARLRVFREFHMHLRLPV
SVRRFEQLELRPVLYNYLDSDLTVSVHVSPVEGLCLAGGGGLAQQVQVPAGSARPVGFSV
VPIAAAAVSLKVVARGSFDFPVGDAISKILQVEREGALHREEMVYELNPLDPRGRTLEIP
GNSDPNIIPEGDFKSFVRVTASDPLEALGSEGALSPGGLASLLRLPQGCGEQTMTLLAPT
LAASRYLDMTEQWSMLPPETKDRAVDLIQKGYTRIQEFRKRDGSYGAWLHRDSSTWLTAF
VLKILSLAQDQVGGSPEKLQETAMWLLSQQXDDGSFHDPFPVMDRSMQGGLVGSDETVAL
TAFVVIALHHGLAVFPEKNSEQLRRVENSISRANTFLGAKATSGLLGAHASAITAYALSL
TEAPEDLRRAAHNNLMAMAKDIGDKLYWGSVTTSPSNVLSPTLAPHSPADPIPQAPALWI
ETTAYGLLHLLLWEGKAELADQAASWLTRQGSFQGGFRSTQDTVVALDALSAYWIASHTT
EEKGLNVTLSSLGRSGLKSHVLQLTNHQVHRLEEELQFSLGSKINVEVRGNSKGTLKVLR
SYNVMDMTNTTCQDLQIEVTVMGHVEYTMEAEEDYQDYEYEDLLAGDDPEAHSRPVTPLQ
LFDGRRNRRRREAPKAAEERESRVQYTVCIWRTGKVGLSGMAIADITLLSGFHALRADLE
KLTSLSDRYVSHFETEGPHILLYFDSVPXSRECVGFGAVQEVPVGLVQPASAILYDYYNP
EHKCSVFYGAPRKSKLLSTLCSADVCQCAEGKCPRQRRALERGQQDLEGYRMKFACYSPR
VDYGFQVKVLREDSRAAFRLFETRITQVLHFTKDARATADQTRNFLVRASCRLQLEPGKE
YLIMGLDGATYDLKGDPQYLLDSNSWIEEMPSERMCQSTRHRTPCAQLNSFLQEYGTQGC
QV
NT seq 5229 nt   +upstreamnt  +downstreamnt
atgaggctcctctgggggctgatctgggcatcttgcttcttcgccttgtctctgcagaag
cccaggttgctcctgttttctccttctgtggttcgcataggggtccccctgtctgtggcc
gtgaaactccaggatgctccttcaggacaggtggtgagaggatctgtgttcctgaggaac
ccatcccatgttaatgagctctgctccccgaaggtggatttcagcctcagctcagacaga
gacttcatactcctcaacgtcccgatcccccaggaacaggccagggtctgtcgcctccat
ctgctccgcagagcccccgaggtgcagctgatggtgcagtcctcatggctaagggactct
ctgtccaaacagacagacatgcagggtgtcaacctgttgttctcctctcgccgggggcac
ctctttctgcagacggaccagcccgtttataaccctggccagcaggttcgctaccgagtc
tttgctctggatcagaagatgcgcccggccactgacatcctcacggtcacggtggagaac
tctcaaggcttccgcgtgcggaaaagggaagtgtttgctccctcctccatcttccaggac
aactttttgatcccagacatctcagcgccaggaacatggaaaatctcagcccgattctca
gacagcctggattctaatagcagcacccagtttgaggtgaaraaatatgttctccccaac
tttgaggtgaagatcattcctgaaaacccctacatcctgacaacacctggctttcttagt
gacatccaagtgatcatccaggccaggtacatctacgggaagccagtgcagggggtggca
tacgtgcgctttgggctcctgggtgaggacggtgaaaagactttcctgcggggcctggag
agtcagaccaagctggtggatggccagtgccaaatttccctgcaaaaggctgagtttcag
ggtgtgctggagaagcttaatattagcactgatgacctcccagggctgcgcctgtatgtt
gcagcagccgttattgagtctccaggaggagagatggaggaggcagagctcacgtcctgg
cgtttcgtgttatctcccttctccctggatctaagcaaaaccaagcagcagcttatacct
ggggtccccttcctgctgcaggccctggtccgtgacatgtcaggctccccagcctctggc
attcccgtcaaagtgtctgccaagttgttttctggatcgacttctaaaaaccgggacttt
gaacagaacacagatgggagcggccaagtcatcgtctccattggtgttcctcggaccatc
tcagaagtgcagctctcagtgtctgcaggctccccctaccctgcggtaggcagtctcact
gtgaaagcrcccctgtccagaagctctgggtttttgtccattgagtggcagaatccgcga
cctcttaaagtcggagagacccttaacctaaacctgcgagccgtgggcatcagtgggagc
ttctcctacttctactacatgatcgtgtcccggggccagatagtgtctgtacatcgagag
cccaggagccacttgacctccatctccgtgtttgtggaccatcacctggtgccctccttm
cacctcgtggccttctactatcacgggggtgtcccggtggccaactccctgcgagtggac
gtccaggctggaggctgtgaggggaagctggagctgaacgtggacagttccaaggcgtat
cgtcctggggacactgtgaaactcaacctgaaaacagagtctcgagccctggtggccctg
ggagctgtggacacggctctgtatgctgtgggtggcaagtcccacaaacccctcgacatg
gtcaaggtcttcgaagctatgaacagctatgaccttggctgtggtcccggcggtggagac
actgcccctcaagtgttcaaagcagctggtctggccttttctgatggagaccatcggact
gaaatcagaaagagtctgagctgtcccaaggagtcaaagtctaggaaaaagagaaatgtg
aacttccaaaaggcgattcatgagaaactgggccagtacacttcccccgtcgccaagcgc
tgctgccaggacgggctgacacggctgcccatgacccgcacctgtgagcagcgggtggcc
cgggtgcagcagccggcctgccgcgagcccttcctgtcctgctgccagtttgccgagagc
ctgcgcaagaaggcccggaccaggggccaggtgggcctggcccgagccatggagctcctg
caggaggaggacctgatcgaagaggatgacatccccgtgcgcagcttcttccccgagaac
tggctttggaaagtggaagaagtggaccgcttctcccaattgcgactgctgctcccggac
tctctgaccacgtgggagatccacggcgtgagcctgtccaaaaccacaggcttgtgtgtg
gccaccccggcccgactccgagtgttccgtgaattccacatgcacctccgcctgccggtc
tctgtccgccgctttgagcagctcgagctgcggcctgtcctctacaactacctagatagc
gatctgactgtgagcgtccacgtgtccccagtggaggggctgtgcctggccgggggtgga
gggctcgcccagcaggtgcaggtgcccgcgggctctgcccggcccgttggcttctctgtg
gtgcccatcgcagctgctgccgtgtccctgaaggtggtggctcgaggatcctttgatttc
cctgtgggggacgcaatatctaagattctacaagtcgagagagaaggggcccttcacagg
gaggagatggtctatgaactcaaccccctggatccccgaggccggaccttggaaattcct
ggcaactctgatcccaatattatccctgaaggagatttcaagagtttcgtcagagtcaca
gcctcggatccactggaagcactgggctctgagggggccttgtcaccaggaggcctggca
tccctcctgaggcttccccaaggctgcggggaacaaaccatgaccctgttggctccaaca
ctggctgcttcccgctacctggacatgacggagcagtggagcatgctgccccctgagacc
aaggaccgcgccgtggatctcatccagaaaggctacacgcggatccaggagtttcgaaaa
agagatggttcctacggggcttggttacatcgggacagtagcacctggctcacggccttt
gtgctgaagatactgagtttggcccaggatcaggtaggcggctcacctgaaaagctgcag
gagacagccatgtggctgctgtcccagcaacrggatgatggctcattccatgatcccttt
ccagtaatggataggagcatgcagggaggcttagtaggaagtgatgagactgtggcgctc
accgccttcgtggtcatcgcccttcaccacgggctggcggtcttcccagagaaaaattct
gagcagttgaggagagtggaaaattccatctcaagagcaaacaccttcttgggggcgaaa
gcaacctctgggctcctgggtgcccacgcctccgccatcacggcctacgccctgtcgctg
accgaggcccctgaggacctgcggagagctgcccacaacaacctgatggccatggccaag
gacatcggtgataagctgtactggggctcagtcaccacttctccaagcaacgtcctgtca
cccactctggctccacacagcccagcagaccccattccccaggctccggccctstggatt
gaaaccacggcctacggcctgctacacctgctgctatgggagggcaaggctgagttggcc
gaccaggctgcatcctggctgacccgccagggcagcttccaagggggattccgcagcacc
caggacactgttgtggctctggacgccctgtctgcgtactggattgcgtcccacaccacc
gaggagaaggggctcaacgtgaccctgagctccttgggccgcagtgggctcaagtcccac
gtgttgcagctgaccaaccaccaagtccacaggctggaggaggagctgcagttttccctg
ggaagcaagattaacgtggaggtgagaggaaacagcaaaggaaccttgaaggtccttcgc
agctacaacgtcatggacatgacgaacacgacctgccaggatcttcagattgaagtgacg
gtcatgggccacgtcgagtacacgatggaggcggaggaggactaccaggactacgagtat
gaggacttgctagccggggatgaccccgaggcccactcccggcccgtgacacccctgcag
ctatttgacggtcggaggaaccgccggaggagggaggcccccaaggcagctgaggagcgg
gaatccagggtgcagtacactgtgtgcatctggcggactggcaaggtggggctgtcaggc
atggccattgcggacatcaccctcctgagtggattccacgccctgcgggctgacctggag
aagctgacctccctctccgaccgttacgtgagccactttgagaccgagggtccccacatc
ctgctgtacttcgactcggtccccmcctcccgggagtgtgtgggctttggagctgtgcag
gaggtgcccgtggggctggtacagccggccagtgccatcctgtatgactactacaaccct
gagcacaagtgttctgtgttttatggggcaccacgtaagagcaaactcttgtccacgttg
tgctctgcggatgtctgccagtgtgctgaggggaagtgccctcgacagcgccgggccctg
gagcgtgggcagcaggacttggagggttaccggatgaaattcgcctgctactctccccga
gtggactacggcttccaggttaaggttctccgagaagacagcagggctgctttccgcctc
tttgagacccgtatcacccaagtcctgcatttcaccaaggatgccagggccaccgctgat
cagaccagaaacttcctggtccgagcctcttgccgccttcagttggaacctgggaaagaa
tatctgatcatgggtctggatggggccacttacgacctcaagggagacccccagtacttg
ctggactcgaacagctggattgaggagatgccctctgagcgcatgtgccagagcacccgc
catcggacaccctgtgcccagctcaacagcttcctccaggagtatggcacacagggctgc
caggtgtga

KEGG   Bos indicus (zebu cattle): 109576944
Entry
109576944         CDS       T04792                                 

Definition
(RefSeq) complement C4
  KO
K03989  complement component 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05133  Pertussis
biu05150  Staphylococcus aureus infection
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109576944
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109576944
  09171 Infectious disease: bacterial
   05133 Pertussis
    109576944
   05150 Staphylococcus aureus infection
    109576944
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109576944
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109576944
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   109576944
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   109576944
  Exosomal proteins of other cancer cells
   109576944
SSDB
Motif
Pfam: TED_complement A2M A2M_recep A2M_BRD NTR MG2 MG3 ANATO MG4 Big_1 SQHop_cyclase_C Kelch_1
Other DBs
NCBI-GeneID: 109576944
NCBI-ProteinID: XP_019841152
Position
23
AA seq 1749 aa
MRLLWGLIWASCFFALSLQKPRLLLFSPSVVRIGVPLSVAVKLQDAPSGQVVRGSVFLRN
PSHVNELCSPKVDFSLSSDRDFILLNVPIPQAQARXCFLHLRRVPEVQLMVQSSWLRDSL
SKQTDMQGVNLLFSSRRGHLFLQTDQPVYNPGQRVRYRVFALDQKMRPATDILTVTVENS
QGFRVQKREVFAPFSIFQDSFLIPDISEPGTWKISARFSDSLDSNSSTQFEVKKYVLPNF
EVKIIPENPYILTTPGFLSDIQVIIQARYIYGKPVQGVAYVRFGLLGEDGEKTFLRGLES
QTKLVDGQCQISLQKAEFQGVLEKLNISTDDLPGLRLYVAAAVIESPGGEMEEAELTSWR
FMSSPFSLDLSKTKQQLIPGVPFLLQALVRDMSGSPASSIPVKVSAKLFSGSTSKNQDFE
QNTDGSGQVIVSIGVPRTISEVQLSVSAGSPYPAVGSLTVKAPLSRSSGFLSIEWQNPRP
LKVGETLKLNLQAVGISGSFSYFYYMIVSRGQIVSVHREPRSHLTSISVFVDHHLVPSFH
LVAFYYHGGVPVANSLRVDVQAGGCEGKXTGIGRDGLELNVDSSKAYRPGDTVKLNLKTE
SRALVALGAVDTALYAVGGKSHKPLDMVKVFEAMNSYDLGCGPGGGDTAPQVFKAAGLAF
SDGDHRTEIRKSLSCPKESKSRKKRNVNFQKAIHEKLGQYTSPVAKRCCQDGLTRLPMAR
TCEQRVARVQQPACRKPFLSCCQFAESLRKKARTRGQVGLARAMELLQEEDLIEEDDIPV
RSFFPENWLWKVEEVDRFSQLRLLLPDSLTTWEIHGVSLSKTTGLCVATPARLRVFREFH
MHLRLPVSVRRFEKLELRPVLYNYLDSDLTVSVHVSPVEGLCLAGGGGLAQQVQVPAGSA
RPVGFSVVPIAAAAVSLKVVARGSFDFPVGDAISKILQVEREGALHREEMVYELNPLDPL
GRTLEIPGNSDPNIIPEGDFKSFVRVTASDPLEALGSEGALSPGGLASLLRLPQGCAEQT
MTLLAPTLAASRYLDKTEQWSMLPPETKDRAVDLIQKGYTRIQEFRKRDGSYGAWLHRDS
STWLTAFVLKILSLAQDQVGGSAEKLQETATWLLSQQRDDGPFHDPCPVIHREMQGGLVG
SDETVALTAFVVIALHHGLAVLPDKNSEQLRRVENSISRANTFLGAKATSGLLGSHASAI
TAYALSLTEAPEDLRRVAHNNLMAMAKDIGDKLYWGSVTTSPSNVLSPTPAPRSPADPIP
QAPAMSIETTAYGLLHLLLWEGKAELADQAASWLTRQGSFQGGFRSTQDTVVALDALSAY
WIASYTAEEKGLNVTLSSLGRSGLKSHVLQLTNHQVHRLEEELQFSLGSKINVEVRGNSK
GTLKVLRSYNVMDMTNTTCQDLQIEVTVMGHVEYTMEAEEDYEDYEYEDLLAGDDPEAHS
RPVTPLQLFDGRRNRRRREAPKAAEERESRVQYTVCIWRTGKVGLSGMAIADITLLSGFH
ALRADLEKLTSLSDRXXSHFETEGPHVLLYFDSVPTSRECVGFGAVQEVPVGLVQPASAI
LYDYYNPEHKCSVFYGAPRKSKLLSTLCSADVCQCAEGKCPRQRRALERGQQDLEGYRMK
FACYSPRVDYGFQVKVLREDSRAAFRLFETRITQVLHFTKDARATADQTRNFLVRASCRL
QLEPGKEYLIMGLDGATYDLKGDPQYLLDSNSWIEEMPSERMCQSTRHRTPCAQLNSFLQ
EYGTQGCQV
NT seq 5250 nt   +upstreamnt  +downstreamnt
atgaggctcctctgggggctgatctgggcatcttgcttcttcgccttgtctctgcagaag
cccaggttgctcctgttttctccttctgtggttcgcataggggtccccctgtctgtggcc
gtgaaactccaggatgctccttcaggacaggtggtgagaggatccgtgttcctgaggaac
ccatcccatgttaatgagctctgctccccgaaggtggatttcagcctcagctcagacaga
gacttcatactcctcaacgtcccgatcccccaggcacaggccaggatstgtttcctccat
ctccgcagagtccccgaggtgcagctgatggtgcagtcctcatggctaagggactctctg
tccaaacagacagacatgcagggtgtcaacctgttgttctcctctcgccgggggcacctc
tttctgcagacggaccagcccgtttataaccctggccagcgggttcgctaccgagtcttt
gctctggatcagaagatgcgcccggccactgacatcctcacggtcacggtggagaactct
caaggcttccgcgtgcagaaaagggaagtgtttgctcccttctccatcttccaggacagc
tttttgattccagacatctcagagccaggaacatggaaaatttcagcccgattctcagac
agcctggattccaatagcagcacccagtttgaggtgaagaaatacgttctccccaacttt
gaggtgaagatcattcctgaaaacccctacatcctgacaacacctggctttcttagtgac
atccaagtgatcatccaggccaggtacatctacgggaagccagtgcagggggtggcatac
gtgcgctttgggctcctgggtgaggacggtgaaaagactttcctgcggggcctggagagt
cagaccaagctggtggatggccagtgccaaatttccctgcaaaaggctgagtttcagggt
gtgctggagaagcttaatattagcactgatgacctcccagggctgcgcctgtatgttgca
gcagctgttattgagtctccaggaggagagatggaggaggcagagctcacrtcctggcgt
ttcatgtcatctcccttctccctggatctaagcaaaaccaagcagcagcttatacctggg
gtccccttcctgctgcaggccctggtccgtgacatgtcaggctccccagcctctagcatt
cccgtcaaagtgtctgccaagttgttttctggatcgacttctaaaaaccaggactttgaa
cagaacacagatgggagcggccaagtcattgtctccattggtgttcctcggaccatctca
gaagtgcagctctcggtgtctgcaggctccccctaccctgcagtaggcagtctcactgtg
aaagcgcccctgtccagaagctctgggtttctgtccattgagtggcagaatccgcgacct
cttaaagtcggagagacccttaagctaaacctgcaagccgtgggcatcagtgggagcttc
tcgtacttctactacatgatcgtgtcccggggccagatcgtgtctgtacatcgagagccc
aggagccacctgacctccatctccgtgtttgtggaccatcacctggtgccctccttccac
ctcgtggccttctactatcacgggggcgtcccggtggccaactccctgcgagtggacgtc
caggctggaggctgtgaggggaagrtaactggcatcggaagagatgggctggagctgaac
gtggacagttccaaggcgtatcgtcctggggacactgtgaaactcaacctgaaaacagag
tctcgagccctggtggccctgggagctgtggacacggctctgtatgctgtgggtggcaag
tcccacaaacccctcgacatggtcaaggtcttcgaagctatgaacagctatgaccttggc
tgtggtcccggtggtggagacactgcccctcaagtgttcaaagcagctggtctggccttt
tctgatggagaccatcggactgaaatcagaaagagtctgagctgtcccaaggagtcaaag
tctaggaaaaagagaaatgtgaacttccaaaaggcgattcatgagaagctgggccagtac
acttcccccgtcgccaagcgctgctgccaggacgggctgacgcggctccccatggcccgc
acctgtgagcagcgggtggcccgggtgcagcagccggcctgccgcaagcccttcctgtcc
tgctgccagtttgccgagagcctgcgcaagaaggcccggaccaggggccaggtgggcctg
gcccgagccatggagctcctgcaggaggaggacctgatcgaagaggatgacatccccgtg
cgcagcttcttccccgagaactggctttggaaagtggaagaagtggaccgcttctcccaa
ttgcgactgctgctcccggactctctgaccacgtgggagatccacggtgtgagcctgtcc
aaaaccacaggcttgtgtgtggccaccccggcccgactccgagtgttccgtgaattccac
atgcacctccgcctgccggtctctgtccgccgctttgagaagctcgagctgcggcctgtc
ctctacaactacctggatagcgatctgactgtgagcgtccacgtgtccccagtggagggg
ctgtgcctggccgggggtggagggctcgcccagcaggtgcaggtgcccgcgggctctgcc
cggcccgttggcttctctgtggtgcccatcgcagctgctgccgtgtccctgaaggtggtg
gctcgaggatcctttgatttccctgtgggggacgcaatatctaagattctacaagtcgag
agagaaggggcccttcacagggaggagatggtctatgaactcaaccccctggatccccta
ggccggaccttggaaattcctggcaactctgatcccaatattatccctgaaggagatttc
aagagtttcgtcagagtcacagcctcggatccactggaagcactgggctctgagggggcc
ttgtcaccaggaggcctggcatccctcctgaggcttccccaaggctgcgcggaacaaacc
atgaccctgttggctccaacactggctgcttcccgctacctggacaagacagagcagtgg
agcatgctgccccctgagaccaaggaccgcgccgtggatctcatccagaaaggctacaca
cggatccaggagtttcgaaaaagagatggttcctacggggcttggttacatcgggacagt
agcacctggctcacggcctttgtgctgaagatactgagtttggcccaggatcaggtgggc
ggctctgctgaaaagctgcaggagacagccacgtggctgctgtcgcagcaacgggatgat
ggcccattccacgacccctgtcctgttatccacagggaaatgcagggaggcttagtggga
agcgatgagactgtggcgctcaccgccttcgtggtcatcgcccttcaccacgggctggcg
gtcctcccagacaagaattctgagcagttgaggagagtggaaaattccatctcaagagca
aacaccttcttgggggcgaaagcaacctctgggctyctgggctcccacgcctccgccatc
acggcctacgccctgtcgctgaccgaggcccccgaggacctgcggagagttgcccacaac
aacctcatggccatggccaaggacatcggtgataagctgtactggggctcagtcaccact
tctccaagcaacgtcctgtcacccactccggctccacgtagcccagcagaccccattccc
caggctccagccatgtcgattgaaaccacggcctacggcctgctacacctgctgctatgg
gagggcaaggctgagttggccgaccaggctgcatcctggctgacccgccagggcagcttc
caagggggattccgcagcacccaggacactgttgtggctctggacgccctgtctgcgtac
tggattgcatcctacaccgccgaggagaaggggctcaacgtgaccctgagctccttgggc
cgcagtgggctcaagtcccacgtgttgcagctgaccaaccaccaagtccacaggctggag
gaggagctgcagttttccctgggaagcaagattaacgtggaggtgagaggaaacagcaaa
ggaaccttgaaggtccttcgcagctacaacgtcatggacatgacgaacacgacctgccag
gatcttcagattgaagtgacggtcatgggccacgtcgagtacacgatggaggcggaggag
gactacgaggactacgagtatgaggacttgctggccggggatgaccccgaggcccactcc
cggcccgtgacacccctgcagctatttgacggtcggaggaaccgccggaggagggaggcc
cccaaggcagctgaggagcgagaatccagggtgcagtacactgtgtgcatctggcggact
ggcaaggtggggctgtcaggcatggccattgcggacatcaccctcctgagtggattccac
gccctgcgggctgacctggagaagctgacctccctctccgaccgttnnnngagccacttt
gagaccgagggtccccacgtcctgctgtacttcgactcggtccccacctcccgggagtgc
gtgggctttggagctgtgcaggaggtgcccgtggggctggtacagccggccagtgccatc
ctgtatgactactacaaccctgagcacaagtgttctgtgttttatggggcaccacgtaag
agcaaactcttgtccacgttgtgctctgcggatgtctgccagtgtgctgaggggaagtgc
cctcgacagcgccgggccctggagcgtgggcagcaggacttggagggttaccggatgaaa
ttcgcctgctactctccccgagtggactacggcttccaggttaaggttctccgagaagac
agcagggctgctttccgcctctttgagacccgtatcacccaagtcctgcatttcaccaag
gatgccagggccaccgctgatcagaccagaaacttcctggtccgagcctcttgccgcctt
cagttggaacctgggaaagaatatctgatcatgggtctggatggggccacttacgacctc
aagggagacccccagtacttgctggactcgaacagctggattgaggagatgccctctgag
cgcatgtgccagagcacccgccatcggacaccctgtgcccagctcaacagcttcctccag
gagtatggcacacagggctgccaggtgtga

DBGET integrated database retrieval system