KEGG   Bos indicus (zebu cattle): 109576932
Entry
109576932         CDS       T04792                                 

Gene name
C2
Definition
(RefSeq) complement C2 isoform X1
  KO
K01332  complement component 2 [EC:3.4.21.43]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05133  Pertussis
biu05150  Staphylococcus aureus infection
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109576932 (C2)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109576932 (C2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109576932 (C2)
   05150 Staphylococcus aureus infection
    109576932 (C2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109576932 (C2)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.43  classical-complement-pathway C3/C5 convertase
     109576932 (C2)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109576932 (C2)
SSDB
Motif
Pfam: VWA Trypsin Sushi VWA_2 HRM Trypsin_2 DUF1986 DUF1194
Other DBs
NCBI-GeneID: 109576932
NCBI-ProteinID: XP_019841135
Position
23
AA seq 787 aa
MDPLMAVLCLLPLYPGLATAALSCPKNVNISGGSFTLSNGWNPGSILTYSCPLGHYPYPV
VTRLCKSNGQWQIPRSTRSTKAICKPVRCPAPVSFENGVYIPRLGSHPVGGNLSFECEDG
FTLRGSAVRQCRPNGMWDGEXAVCDNGASHCPNPGISVGAVRTGSRFGLGDKVRYRCSSN
LVLTGSAERECQDDGVWSGTEAICRQPYSYDFPEDVAPALGTSFSHLLATTNPIQQKKKQ
NLGRKIQIQRSGHLNLYLLLDASQSVSKDDFEIFKDSASRMVDRIFSFEIKVSVAIITFA
SKPKIIMSVLEDRSRDVTEVENSLRNINYKDHENGTGTNIYEALHAVYIMMNNQMNRPHM
NPGAWQEIRHAIILLTDGKSNMGGSPKVAVDNIKEVLNINQKRKDYLDIYAIGVGSLHVD
WKELNNLGSKKDGERHAFILKDVQALSQVFEHMLDVSQLTDPICGVGNMSANASAQERTP
WHVTIKPKSQETCRGALISDQWVLTAAHCFRNAEDRTLWRVSVGDPNFQGSKEFQIEEAV
ISPGFNVFSKKSQGIPEFYGDDIALLKLTQKVKMSTHARCRGLGWEGTLYRGGCPGEPWR
RGHQGWASVTLALLLRPICLPCTVGANLALRKLPGSTCRDHEKELLNQVSIPAHFVALNG
DKLNINLKTGSEWTNCVKVVLXDKTTFPNLTDVREVVTDQFLCSGTQGDDSPCKGESGGA
VFLERRLRFFQVGLVSWGLYNPCGGSSKNSRKPAPHGKVPRDFHINLFRLQPWLRQHLEG
ILNFVPL
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggacccactgatggccgtactttgcctgctgcccctgtacccaggtttggctacagcc
gcgctttcctgccccaagaacgtgaatatctctggtggcagtttcaccctcagcaacggc
tggaaccctgggagtatcctcacctactcctgccccctgggccattacccatacccygtg
gtgacaaggctgtgcaagagcaacggacagtggcaaatcccgagatccactcggtcgaca
aaggcaatctgcaaacctgttcgctgtccagcccctgtttcctttgagaacggtgtgtac
atcccacggctggggtcccacccagtgggcggcaacctgagctttgaatgtgaggatggc
ttcaccctgcggggctcagctgttcggcagtgtcggcccaacggcatgtgggatggcgag
ayggccgtgtgtgacaatggtgccagtcactgccccaacccgggcatttccgtgggtgca
gtgcggaccgggtctcgcttcggccttggggacaaggtcagataccgctgctcctcgaat
ctggtgctgacagggtctgcggagcgcgagtgccaggacgacggggtctggagtgggacg
gaggccatctgccgccagccctactcctacgactttcctgaggatgtrgcccccgccctg
ggcacctccttctcccacttacttgcaaccaccaatcccatccagcagaagaagaaacaa
aacttgggccgcaaaatacaaatccagcgttccggtcacctgaacctctacctgctcctg
gacgcctctcagagtgtgtccaaagatgactttgaaatcttcaaggacagcgcctcccgc
atggtggacaggatcttcagctttgagatcaaggttagtgtcgccatcatcacttttgca
tcaaagcccaaaatcatcatgtctgtcttggaagacagatcccgggatgtgactgaagtg
gagaacagtctgagaaatatcaactataaagaccatgaaaatggaactgggaccaacatc
tacgaggccctccacgctgtctatataatgatgaataaccaaatgaatcggccccatatg
aacccaggggcctggcaggaaatccgacatgccatcatccttctgacagatggaaagtcc
aacatgggcggctctcccaaggtggctgttgacaatatcaaagaagtcttgaacatcaac
cagaagaggaaagactatctggacatctatgccatcggtgtgggcagcctacacgtggac
tggaaagaactgaataacctggggtccaagaaggacggcgagaggcaygccttcattctg
aaggatgtacaggcsctgagccaggtcttcgagcacatgctggatgtctcccagctcaca
gaccccatctgtggggtagggaacatgtctgccaatgcctctgcccaggagaggacaccc
tggcacgtcactattaagcccaagagccaggagacctgccggggggccctcatctccgac
cagtgggtcctgacagccgctcactgcttccgcaatgccgaggaccgcacgctgtggagg
gtcagtgtgggggatcccaactttcaggggagcaaagaattccaaattgaggaggcagtg
atctccccaggcttcaatgtcttttccaagaagagtcagggaatcccagagttctatggc
gatgacattgctttgctaaagctgacccagaaagtgaagatgtccacccatgctaggtgc
aggggtctgggatgggagggcaccctctataggggagggtgtcctggggagccctggagg
agggggcaccaaggatgggcctctgtgaccctggcccttctcctcaggcccatctgcctc
ccctgcacggtgggggccaacctggctctgcggaaactcccaggcagtacctgccgagat
catgagaaggagcttctgaaccaagtgagcattcccgctcattttgtggctttgaacggg
gataarctgaatattaatctcaagacagggtcagagtggacaaactgtgtcaaggtcgtc
ctcraagacaaaaccacgttccccaacctgacagatgtcagagaggtggtgacagaccag
ttcctatgcagtgggacccagggggatgacagtccctgcaagggagaatctggaggagca
gttttccttgagcggagactcaggttttttcaggtgggcctggtgagctggggtctctac
aacccctgtggcggctccagtaagaactcccgcaaacctgcgccccatggcaaggtcccg
cgagatttccacatcaacctcttccgcctgcagccctggctcaggcagcatctggagggc
atcctgaactttgtgcccctctaa

DBGET integrated database retrieval system