KEGG   Bos indicus (zebu cattle): 109576933
Entry
109576933         CDS       T04792                                 

Gene name
CFB
Definition
(RefSeq) complement factor B
  KO
K01335  complement factor B [EC:3.4.21.47]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109576933 (CFB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109576933 (CFB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109576933 (CFB)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.47  alternative-complement-pathway C3/C5 convertase
     109576933 (CFB)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109576933 (CFB)
SSDB
Motif
Pfam: Trypsin VWA Sushi VWA_2 HRM DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 109576933
NCBI-ProteinID: XP_019841138
Position
23
AA seq 761 aa
MGIGHNPRLCLVPLILGLLCGGVGMTPLPEAGPQSPCSLEGVEIKGGSFRLLKAGQVLEY
LCPSGFYPYPTQIRTCRSTGSWSTLQTQDRKIVKRAECKAIRCPRPQDFENGEYWPRAAY
YNLSDEISFRCYDGYTLRGSANRTCQGNGRWDGETAICDDGATYCPNPGIPLGTRKVGSQ
YRLEDRVTYYCNRGLTLRGSEQRTCLEGGSWSGTEPSCQDSFMYDTPAEVAEAFLSSLTE
TIEGVDAEDGHSPGEQQKRKIVLDPSGSMNIYLVLDGSDSVGAHNFTGAKNCLRDFIEKV
ASYGVKPKYGLVTYATEPKVLIRVSDPKSSEADWVTDQLNQINYADHKLKAGTNTKRALL
EVYNMMSREVNQFKETWNRTRHVIIIMTDGLHNMGGDPVTVIHDIRYLLDIGRNRKNPRE
DYLDIYVFGVGPLVNQENINALASKKDKEKHVFKLQGMENLEDVFVQMLDESRTLGLCGM
VWEHKDGTAYHKQPWQAKISVTRPSKGHESCMGAIVSEYFVLTAAHCFTVDDEKHSIKVS
LGGQRKEWEVKEILFHPKYDLNAKKAKGIPEFYDYDVALVRLKEKLKYETTIRPICLPCT
EGSIQALRLPRSTTCQQQMQELLPAKDIEALFVSESKKTLTRKAVYIKNGDKKASCERDA
LRAPGYEKVKDVSEVVTPRFLCTGGVDPYADPNTCKGDSGGPLIIHKRSRFIQVGVISWG
VVDVCKRPQQVPGYARDFHINLYQVLPWLKEKLQNEDLGFL
NT seq 2286 nt   +upstreamnt  +downstreamnt
atggggattggtcacaacccccgactctgcctggtacccttgatcctgggcctcttgtgt
ggaggtgtgggcatgacgccattgcctgaggctgggccccaaagcccctgctctctggag
ggagtagagatcaaaggtggctccttccggcttctcaaggcgggccaggtgctggagtac
ttgtgtccttctggcttctacccataccccacgcagattcgcacctgcagatccacaggg
tcctggagcaccctgcagactcaagacagaaagattgtcaagagggctgaatgcaaagca
attcgctgtcccagaccacaggattttgagaatggggagtactggccccgggctgcctac
tacaatttgagcgatgagatctctttccgctgctatgatggctacactcttcggggctct
gccaatcgcacctgccaagggaatggtcggtgggatggggaaacggccatctgtgatgat
ggagcgacgtactgccccaacccgggcatcccccttggcacgaggaaggtgggcagccag
taccgccttgaagaccgtgtcacctactactgcaaccgggggctcactctacgtggttct
gagcagcgaacatgcctggaaggtggctcttggagtggaacggagccttcctgccaagac
tcctttatgtacgacactcctgcagaggtggccgaagctttcctgtcttccctgacagag
accatagaaggagttgatgccgaggatggacatagcccaggggaacaacagaagagaaag
attgtcctggacccctcaggctccatgaacatctacctggtattggatggatcagacagc
gtgggggcccacaacttcacaggggccaagaattgtctcagagatttcatcgagaaggtg
gcaagctatggggtgaagccaaaatatggtctagtgacatatgccacagaacccaaagtt
ttgatcagagtgtccgacccaaagagcagcgaagcagactgggtcacagaccagctcaac
caaatcaactacgcagatcacaagttgaaggcagggaccaataccaagagggctctcctg
gaagtgtacaacatgatgagcagggaagtaaaccagttcaaagagacctggaaccgcacg
cgccacgtcatcatcatcatgactgacggtttgcacaacatgggtggggatccagtcact
gtcattcacgatattcggtacttgctagacattggtagaaatcgcaaaaaccccagggag
gattatctggatatctatgtgttcggggttggacctctagtgaaccaagagaacatcaat
gctttggcttccaagaaggataaagagaaacacgtgttcaaactccaaggcatggaaaac
ctggaggatgttttcgtccaaatgcttgatgaaagccggacactgggtctctgtggcatg
gtttgggagcacaaggatggtactgcctaccacaagcaaccgtggcaggccaagatctcg
gtcactcgcccttcaaaggggcatgagagctgtatgggtgctattgtgtctgagtacttt
gtgctgacggctgcacactgtttcactgtggatgatgagaaacactcaatcaaggtcagc
ctgggaggacagaggaaggagtgggaggtaaaagaaatcctatttcatccgaagtacgac
ctcaatgcaaaaaaagcaaaaggcattcctgagttttatgactatgacgtggccctcgtc
aggctcaaggaaaagctcaagtatgagaccaccatcaggcccatttgtctcccctgcact
gagggatcgattcaagccttgaggcttccaaggtcaaccacatgccagcaacagatgcaa
gagctactccctgcaaaggacattgaagctctgtttgtgtctgagtctaagaagaccctg
actcggaaggcagtctacatcaagaatggggacaagaaagccagctgtgagagagatgct
ctacgcgccccaggttatgaaaaagtcaaggacgtctctgaggtagtcacccccaggttc
ctctgcactggaggtgtggatccctacgctgaccccaacacttgcaaaggtgattctggt
ggccccctgattattcacaagaggagtcgcttcattcaagttggcgtgatcagctggggc
gtcgtggatgtttgcaagcggccacagcaagtacctggttatgctcgagactttcacatc
aacctctaccaggtgctgccctggctcaaggaaaaactccaaaatgaggatctgggtttt
ctataa

DBGET integrated database retrieval system