KEGG   Bos indicus (zebu cattle): 109577010
Entry
109577010         CDS       T04792                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu04010  MAPK signaling pathway
biu04015  Rap1 signaling pathway
biu04068  FoxO signaling pathway
biu04071  Sphingolipid signaling pathway
biu04114  Oocyte meiosis
biu04218  Cellular senescence
biu04261  Adrenergic signaling in cardiomyocytes
biu04370  VEGF signaling pathway
biu04380  Osteoclast differentiation
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04611  Platelet activation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04668  TNF signaling pathway
biu04670  Leukocyte transendothelial migration
biu04714  Thermogenesis
biu04722  Neurotrophin signaling pathway
biu04723  Retrograde endocannabinoid signaling
biu04728  Dopaminergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04912  GnRH signaling pathway
biu04914  Progesterone-mediated oocyte maturation
biu04917  Prolactin signaling pathway
biu04926  Relaxin signaling pathway
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu05014  Amyotrophic lateral sclerosis
biu05020  Prion disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05132  Salmonella infection
biu05133  Pertussis
biu05135  Yersinia infection
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05205  Proteoglycans in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109577010 (MAPK14)
   04015 Rap1 signaling pathway
    109577010 (MAPK14)
   04370 VEGF signaling pathway
    109577010 (MAPK14)
   04668 TNF signaling pathway
    109577010 (MAPK14)
   04068 FoxO signaling pathway
    109577010 (MAPK14)
   04071 Sphingolipid signaling pathway
    109577010 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109577010 (MAPK14)
   04218 Cellular senescence
    109577010 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109577010 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109577010 (MAPK14)
   04620 Toll-like receptor signaling pathway
    109577010 (MAPK14)
   04621 NOD-like receptor signaling pathway
    109577010 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    109577010 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    109577010 (MAPK14)
   04660 T cell receptor signaling pathway
    109577010 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    109577010 (MAPK14)
   04659 Th17 cell differentiation
    109577010 (MAPK14)
   04657 IL-17 signaling pathway
    109577010 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    109577010 (MAPK14)
   04670 Leukocyte transendothelial migration
    109577010 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    109577010 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    109577010 (MAPK14)
   04917 Prolactin signaling pathway
    109577010 (MAPK14)
   04926 Relaxin signaling pathway
    109577010 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    109577010 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109577010 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    109577010 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    109577010 (MAPK14)
   04722 Neurotrophin signaling pathway
    109577010 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109577010 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109577010 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    109577010 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109577010 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109577010 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109577010 (MAPK14)
   05020 Prion disease
    109577010 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    109577010 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109577010 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109577010 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109577010 (MAPK14)
   05135 Yersinia infection
    109577010 (MAPK14)
   05133 Pertussis
    109577010 (MAPK14)
   05152 Tuberculosis
    109577010 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109577010 (MAPK14)
   05161 Hepatitis B
    109577010 (MAPK14)
   05163 Human cytomegalovirus infection
    109577010 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109577010 (MAPK14)
   05169 Epstein-Barr virus infection
    109577010 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109577010 (MAPK14)
   05140 Leishmaniasis
    109577010 (MAPK14)
   05142 Chagas disease
    109577010 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109577010 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109577010 (MAPK14)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109577010 (MAPK14)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109577010 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 109577010
NCBI-ProteinID: XP_019841278
Position
23
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagaccatctgggaggtg
cccgagcgttaccagaacctgtccccggtgggctccggcgcctatggctccgtgtgtgct
gcttttgacacaaaaactgggttacgtgtcgcagtgaagaagctatccagaccatttcag
tccattattcatgccaaaagaacctacagagaactgcggttacttaaacatatgaagcat
gaaaatgtaattggtctgttggatgttttcacacctgcaaggtctctggaggaattcaat
gatgtgtacctggtgacccatctcatgggggcagatctgaacaacatcgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccagattctcagaggtctcaagtat
atacattcagccgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagatcttggatttcggactggctcgacatacagatgatgaaatgaca
ggctatgtggccaccaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acgttgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactacattcag
tctttgacccagatgccgaagatgaactttgcaaatgtatttattggtgccaatcccttg
gctgtcgacctgctggagaagatgcttgtattggactcagataagagaatcacagcagca
caagcccttgcacatgcctacttcgcccagtaccacgatcctgacgacgaaccagtggct
gatccttacgatcagtcttttgaaagcagggacctccttatagacgaatggaaaagcctg
acctatgatgaagtcatcagctttgtgccgccaccccttgaccaagaagagatggagtct
tga

KEGG   Bos indicus (zebu cattle): 109577419
Entry
109577419         CDS       T04792                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu04010  MAPK signaling pathway
biu04015  Rap1 signaling pathway
biu04068  FoxO signaling pathway
biu04071  Sphingolipid signaling pathway
biu04114  Oocyte meiosis
biu04218  Cellular senescence
biu04261  Adrenergic signaling in cardiomyocytes
biu04370  VEGF signaling pathway
biu04380  Osteoclast differentiation
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04611  Platelet activation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04668  TNF signaling pathway
biu04670  Leukocyte transendothelial migration
biu04714  Thermogenesis
biu04722  Neurotrophin signaling pathway
biu04723  Retrograde endocannabinoid signaling
biu04728  Dopaminergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04912  GnRH signaling pathway
biu04914  Progesterone-mediated oocyte maturation
biu04917  Prolactin signaling pathway
biu04926  Relaxin signaling pathway
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu05014  Amyotrophic lateral sclerosis
biu05020  Prion disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05132  Salmonella infection
biu05133  Pertussis
biu05135  Yersinia infection
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05205  Proteoglycans in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109577419 (MAPK13)
   04015 Rap1 signaling pathway
    109577419 (MAPK13)
   04370 VEGF signaling pathway
    109577419 (MAPK13)
   04668 TNF signaling pathway
    109577419 (MAPK13)
   04068 FoxO signaling pathway
    109577419 (MAPK13)
   04071 Sphingolipid signaling pathway
    109577419 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109577419 (MAPK13)
   04218 Cellular senescence
    109577419 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109577419 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109577419 (MAPK13)
   04620 Toll-like receptor signaling pathway
    109577419 (MAPK13)
   04621 NOD-like receptor signaling pathway
    109577419 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    109577419 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    109577419 (MAPK13)
   04660 T cell receptor signaling pathway
    109577419 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    109577419 (MAPK13)
   04659 Th17 cell differentiation
    109577419 (MAPK13)
   04657 IL-17 signaling pathway
    109577419 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    109577419 (MAPK13)
   04670 Leukocyte transendothelial migration
    109577419 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    109577419 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    109577419 (MAPK13)
   04917 Prolactin signaling pathway
    109577419 (MAPK13)
   04926 Relaxin signaling pathway
    109577419 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    109577419 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109577419 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    109577419 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    109577419 (MAPK13)
   04722 Neurotrophin signaling pathway
    109577419 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109577419 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109577419 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    109577419 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109577419 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109577419 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109577419 (MAPK13)
   05020 Prion disease
    109577419 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    109577419 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109577419 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109577419 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109577419 (MAPK13)
   05135 Yersinia infection
    109577419 (MAPK13)
   05133 Pertussis
    109577419 (MAPK13)
   05152 Tuberculosis
    109577419 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109577419 (MAPK13)
   05161 Hepatitis B
    109577419 (MAPK13)
   05163 Human cytomegalovirus infection
    109577419 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109577419 (MAPK13)
   05169 Epstein-Barr virus infection
    109577419 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109577419 (MAPK13)
   05140 Leishmaniasis
    109577419 (MAPK13)
   05142 Chagas disease
    109577419 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109577419 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109577419 (MAPK13)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109577419 (MAPK13)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109577419 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 APH Kinase-like Kdo DUF4023
Other DBs
NCBI-GeneID: 109577419
NCBI-ProteinID: XP_019841900
Position
23
AA seq 366 aa
MSFTRKKGFYKQDVNKTAWELPKTYVSLTHIGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM
EFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHTDVEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLNDKAAKSYIQSLPQSPKKDFSQLFPRASPQATDLLEKMLELDVDKRLTAS
QALAHPFFEPFRDPEEETEAQQPLEDSLEREKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcttcacccggaaaaagggcttctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccctgacgcacataggcagcggggcctacggctcagtgtgc
tcagccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccggcccttc
cagtccgagatctttgccaagcgggcttatcgggagctgctgctgctgaaacacatgcag
catgaaaacgtcatcgggcttctggatgtcttcaccccagcctcctccctgcgcaacttc
catgacttctacctggtgatgcccttcatgcagacggacctgcagaagatcatggggatg
gagttcagtgaggacaagatccagtacctggtgtaccagatgctcaagggtcttaagtac
atccactcagctggggtcgtccacagggacctgaagccgggcaacctcgctgtgaatgag
gactgtgagctgaagatcttggattttgggttggcacggcatacggatgtggagatgacg
ggttacgtggtgacccgctggtaccgggcccctgaggtgattctcagctggatgcattac
aatcagactgtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaag
acgctgttcaaggggaaagactacctggaccagctgacccagattctgaargtgaccggg
gtgccgggtgcagagtttgtgcagaagctcaatgacaaggcggccaaatcctacatccag
tccctgccacaaagccccaaaaaggatttctctcagctmttcccgcgtgccagcccccag
gccacagacctgctggagaagatgctggagctggacgtggacaagcgcctgacggcctcg
caggccctcgcccaccccttctttgagcccttccgggaccctgaggaggagacagaggcc
cagcagccgctcgaggattccttagaacgcgagaaactcacagtggacgaatggaagcag
cacatctacaaggagatcgtgaacttcagccccattgcccggaaggactctcggcgccgg
agtggcatgaagctgcagtga

DBGET integrated database retrieval system