KEGG   Bos indicus (zebu cattle): 109577076
Entry
109577076         CDS       T04792                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7-like isoform X1
  KO
K06751  MHC class I antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04144  Endocytosis
biu04145  Phagosome
biu04218  Cellular senescence
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04940  Type I diabetes mellitus
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05203  Viral carcinogenesis
biu05320  Autoimmune thyroid disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577076
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109577076
   04145 Phagosome
    109577076
  09143 Cell growth and death
   04218 Cellular senescence
    109577076
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109577076
   04612 Antigen processing and presentation
    109577076
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109577076
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109577076
   05330 Allograft rejection
    109577076
   05332 Graft-versus-host disease
    109577076
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109577076
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109577076
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577076
   05170 Human immunodeficiency virus 1 infection
    109577076
   05168 Herpes simplex virus 1 infection
    109577076
   05163 Human cytomegalovirus infection
    109577076
   05167 Kaposi sarcoma-associated herpesvirus infection
    109577076
   05169 Epstein-Barr virus infection
    109577076
   05165 Human papillomavirus infection
    109577076
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109577076
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109577076
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109577076
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Antigens
  109577076
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 109577076
NCBI-ProteinID: XP_019841385
Position
23
AA seq 383 aa
MGPRTLLLLLSGVLVLTETWAGSHSLSYFNTGVYQPGLGEPRFFAVGYVDDTQFARFDSD
APNPRMEPRAPWMEQEGPEYWEEMTRDAKESQQKSRLCLYNLRGYYNQSEAESHILQVMF
GCEVGPDGRLLRGFWQKAYDGRDYIALNEDLRSWTAADTVAQITKCKWDVSGQAKIQRNY
LEVKCVQWLLRHLETGKDTLLRADPPKTHVAHHRISDREVTLRCWALGFYPKEITLTWQQ
DGEDLTQDMELVETRPSGDGTFQKWAALVVPSGEEQRYTCRVQHEGLQEPLTLRWEPPQL
SVLIKGIIVGLILLMVTGAVVTGAXIWRKKHSGEKGRGYTQTASSDSAQGSDVSLTVPKG
ETLGLLDWERSWGRGNTLGGRGL
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggggccgcgaaccctcctcctcttgctctcgggggtcctggtcctgaccgagacctgg
gccggctcccactccctgagctatttcaacaccggagtgtaccagcccggcctcggggag
ccgcgattctttgccgtcggctacgtggacgacacgcagttcgcgcggttcgacagcgac
gccccgaatccgagaatggagccgcgggcgccgtggatggagcaggagggcccggaatat
tgggaagagatgacacgagatgccaaggaaagtcaacagaaatcccgattatgcttgtac
aacctgcgcggctactacaaccagagcgaggccgagtctcacatcctccaggtgatgttt
ggctgcgaagtggggccggacgggcgcctgctccgtggattctggcagaaggcctacgac
ggcagagattacatcgccctgaacgaagacctgcgctcctggaccgcagcggacacggtg
gctcagatcaccaagtgcaagtgggatgtctccgggcaggcaaagatccaacggaactac
ctagaggtcaagtgcgtgcagtggctcctcagacacctggagacgggaaaggacacgctg
ctgcgcgcagaccctccaaagacacatgtggcccatcaccgcatctctgaccgtgaggtc
accctgaggtgctgggccctgggcttctaccctaaggagatcacactgacctggcagcaa
gacggggaagacctgactcaggacatggagcttgtggagaccaggccttcaggggatgga
accttccagaagtgggcggccctggtggtgccttctggagaggagcagagatacacgtgc
cgtgtgcagcacgaggggcttcaggagcccctcaccctgagatgggaacctcctcagctc
tctgtcctcatcaagggcatcattgttggcctgattctcctcatggtcactggagctgtg
gtgactggagctrtgatttggaggaagaagcactcaggtgaaaaaggaaggggctacacc
cagactgcaagcagtgacagtgcccagggctctgatgtgtctctcacagttcctaaaggt
gagaccctggggcttttagattgggagaggagttggggcagagggaacacactgggtggc
aggggtctctga

DBGET integrated database retrieval system