KEGG   Bos indicus (zebu cattle): 109577264
Entry
109577264         CDS       T04792                                 

Gene name
RIPK1
Definition
(RefSeq) receptor-interacting serine/threonine-protein kinase 1
  KO
K02861  receptor-interacting serine/threonine-protein kinase 1 [EC:2.7.11.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04064  NF-kappa B signaling pathway
biu04210  Apoptosis
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04668  TNF signaling pathway
biu05132  Salmonella infection
biu05160  Hepatitis C
biu05163  Human cytomegalovirus infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109577264 (RIPK1)
   04668 TNF signaling pathway
    109577264 (RIPK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109577264 (RIPK1)
   04217 Necroptosis
    109577264 (RIPK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109577264 (RIPK1)
   04621 NOD-like receptor signaling pathway
    109577264 (RIPK1)
   04622 RIG-I-like receptor signaling pathway
    109577264 (RIPK1)
   04623 Cytosolic DNA-sensing pathway
    109577264 (RIPK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109577264 (RIPK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109577264 (RIPK1)
   05160 Hepatitis C
    109577264 (RIPK1)
   05163 Human cytomegalovirus infection
    109577264 (RIPK1)
   05169 Epstein-Barr virus infection
    109577264 (RIPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109577264 (RIPK1)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109577264 (RIPK1)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   109577264 (RIPK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Death Kdo RHIM RIO1 IP_trans Kinase-like
Other DBs
NCBI-GeneID: 109577264
NCBI-ProteinID: XP_019841710
Position
23
AA seq 665 aa
MSLDDIKMSSTDFLEQADLDSGGFGKVCLCLHRSHGLVILKKVYTGPKRTEYNEALLEEG
RMMHRLRHRRVVKLLGVIMEEGSYSLVMEYMEQGDLMRVLKAQVSIPLSVKGRIIMETIE
GMRYLHGEGVIHKDLKPENILVDSDFHIKIADLGVASFKTWSKLTKEEHNEQRKAGGSAG
KSGGTLHYMAPEHLNDVNSRPSEKSDVFSFAIVLWAIFANKEPYENAICEQQLILCIKSG
NRPDVEDIIEFCPREVIDIMRQCWEVNPDNRPTFAGIEEKFRPFYSNQLEDYVEEDVKSL
KKEFPGQNEIVKRMKSLQIDCVAIAPSRSNSATEQPSSLHSSQGFGMGPVEESWFAPAPD
HQPEENDFLLHSKLQEEANYHLYGSRMDRRTKEQPRPNMAYSSEEERRRRVSHDPFAQQR
PYENAQSPGIKGLAYPGVMSHTSAAQQPAGLSSQPQSPYWRDGSFHPLGVRPLDLGTMSP
RVWYGPNPGHMPSLYKTPVPETNLLGNTPTIPFTSLPSRDESSKYTIHSSSGIQIGDSNY
MEIGGMSSSVLDSTYMNLKEEPASKYQAIFDNSTSLTDKHLDPVRENLGRHWKNCARKLG
FSESQIDEIDHDYERDGLKEKVYQMLQKWLMRAGSKGATVGKLACALYLCSRIDLVNCLI
RISQS
NT seq 1998 nt   +upstreamnt  +downstreamnt
atgtccttggacgacattaaaatgagttctacagacttcctggagcaggcagacctggac
agtgggggcttcgggaaggtgtgtctgtgtttacacagatcccacggactggtgatcctg
aagaaggtgtacacgggccccaagcgcaccgagtacaacgaggccctcctggaggagggc
aggatgatgcaccggctgcggcaccgtcgcgtggtcaagctgctgggcgtcatcatggag
gagggcagctactcactggtgatggagtacatggagcagggcgacctcatgcgcgtgctc
aaggcccaggtcagcatccccctgtccgtgaaagggaggatcattatggagaccatcgaa
ggaatgcgctacctccacggagaaggggtgatacacaaggacctcaagccagaaaatatc
ctcgttgacagcgacttccacatcaagatagctgacctcggcgtcgcttccttcaagacg
tggagcaagctgacgaaggaggagcacaatgagcagcggaaggcgggcggcagtgccggg
aagagcggtggcacgctgcactacatggcccctgagcacctgaacgacgtcaactccagg
ccctccgagaagtccgacgtgttcagctttgccatcgtgctctgggcgatcttcgccaac
aaggagccatacgagaacgccatctgtgagcagcagctgatactgtgcatcaagtctggg
aacaggccagacgtggaggacatcattgagttctgcccgcgggaggttattgacatcatg
aggcagtgctgggaggtgaacccggacaaccggcccacgttcgcgggcattgaagaaaaa
tttaggcctttttattcaaatcaattggaagactatgtagaagaggatgtgaagagttta
aagaaagagtttccaggccaaaatgaaattgtaaagagaatgaagtctctccaaattgac
tgtgtggcaatagctccaagcaggtcaaattcagccacagaacagcccagttcactgcac
agctcacagggcttcggcatgggtcccgtggaggagtcctggtttgctcccgccccagat
caccagccggaggagaatgacttcctgctgcacagtaaactccaggaagaggccaactac
cacctttatggcagccgcatggacaggcgtacaaaagagcagcctagaccaaacatggct
tacagcagtgaggaggagaggaggcgcagggtctcccatgacccttttgcacaacagaga
ccttatgagaatgctcagagcccagggataaaaggcctcgcttaccctggtgtgatgagt
cacaccagtgcagcccagcagccagcggggctaagcagccaaccccagtcaccatactgg
agagatggatcatttcatccacttggagtgagaccgctggacctggggaccatgagtcca
cgagtttggtatgggccaaacccaggccacatgccaagcctgtataaaactccagtgcct
gagaccaacctcctggggaacacacccaccattccattcacctccttgccatcaagagat
gagtcttcaaaatataccatacacagcagttctggcattcagattggcgacagtaattac
atggagattggtggaatgagttcatcggtgctcgacagcacatacatgaacttgaaagaa
gagccggcttctaagtaccaagctatctttgataatagcactagtctgactgataaacac
ctggacccggtcagggagaatctggggagacactggaaaaactgtgcccgtaagctgggt
ttctctgaatctcagatcgatgaaattgaccacgactatgagcgagatggactgaaagaa
aaggtttaccagatgctccaaaagtggctgatgcgggccggcagcaagggggccacagtg
ggaaagctggcctgtgcgctctacctgtgctcgcggatagacctggtcaactgcttgatc
cgcatcagccagagctaa

DBGET integrated database retrieval system