KEGG   Bos indicus (zebu cattle): 109577301
Entry
109577301         CDS       T04792                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04141  Protein processing in endoplasmic reticulum
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu05132  Salmonella infection
biu05160  Hepatitis C
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05203  Viral carcinogenesis
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05216  Thyroid cancer
biu05217  Basal cell carcinoma
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109577301 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109577301 (BAK1)
   04215 Apoptosis - multiple species
    109577301 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109577301 (BAK1)
   05202 Transcriptional misregulation in cancer
    109577301 (BAK1)
   05206 MicroRNAs in cancer
    109577301 (BAK1)
   05203 Viral carcinogenesis
    109577301 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109577301 (BAK1)
   05212 Pancreatic cancer
    109577301 (BAK1)
   05225 Hepatocellular carcinoma
    109577301 (BAK1)
   05226 Gastric cancer
    109577301 (BAK1)
   05214 Glioma
    109577301 (BAK1)
   05216 Thyroid cancer
    109577301 (BAK1)
   05220 Chronic myeloid leukemia
    109577301 (BAK1)
   05217 Basal cell carcinoma
    109577301 (BAK1)
   05218 Melanoma
    109577301 (BAK1)
   05213 Endometrial cancer
    109577301 (BAK1)
   05224 Breast cancer
    109577301 (BAK1)
   05222 Small cell lung cancer
    109577301 (BAK1)
   05223 Non-small cell lung cancer
    109577301 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109577301 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109577301 (BAK1)
   05162 Measles
    109577301 (BAK1)
   05164 Influenza A
    109577301 (BAK1)
   05160 Hepatitis C
    109577301 (BAK1)
   05168 Herpes simplex virus 1 infection
    109577301 (BAK1)
   05163 Human cytomegalovirus infection
    109577301 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109577301 (BAK1)
   05169 Epstein-Barr virus infection
    109577301 (BAK1)
   05165 Human papillomavirus infection
    109577301 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109577301 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:biu03029]
    109577301 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:biu02000]
    109577301 (BAK1)
Mitochondrial biogenesis [BR:biu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    109577301 (BAK1)
Transporters [BR:biu02000]
 Other transporters
  Pores ion channels [TC:1]
   109577301 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 109577301
NCBI-ProteinID: XP_019841749
Position
23
AA seq 211 aa
MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPTDPEM
VTLHPEPSSTMGQVGRQLAVIGDDINRRYDAEFQAMLQHLQPTADNAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLRRSIARWIAQRGGWVAA
LDLGNGPIKSVAIVLAVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcttccggacaaggcccaggtccccccgggcaggactgcgacgagcctgacccctcc
tccacctcggaggagcaggtggcccgggacaccgaggaggtcttccgcagctacgtcttt
taccgccatcagcaggaacaggaggccgagggggcggctgcgcctactgacccagagatg
gtcaccytgcacccagaacctagcagcaccatggggcaggtgggccgccagctcgccgtc
atcggggaygacatcaaccggcgctaygatgcggagttccaggccatgctgcagcacctg
cagccaacagcagacaacgcctatgagtacttcaccaagatcgcgtccagcctgtttgag
agcggtatcaactggggccgcgtggtggctctgctgggctttggctaccgcctggccctc
cacgtctaccagcgcggcctgaccggcttcctgggccaggtgacccgcttcgtggccgac
ttcatgctgcgtcgctccatcgcccggtggatcgcgcagaggggtggctgggtggcagcc
ctggacttggggaacggccccatcaagagcgtagccatcgttctggctgtggttttgttg
ggccagtttgtggtacgaagattcttcaagtcatga

DBGET integrated database retrieval system