KEGG   Bos indicus (zebu cattle): 109577316
Entry
109577316         CDS       T04792                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM beta chain isoform X1
  KO
K06752  MHC class II antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04672  Intestinal immune network for IgA production
biu04940  Type I diabetes mellitus
biu05140  Leishmaniasis
biu05145  Toxoplasmosis
biu05150  Staphylococcus aureus infection
biu05152  Tuberculosis
biu05164  Influenza A
biu05166  Human T-cell leukemia virus 1 infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05322  Systemic lupus erythematosus
biu05323  Rheumatoid arthritis
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109577316
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109577316
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109577316
   04612 Antigen processing and presentation
    109577316
   04658 Th1 and Th2 cell differentiation
    109577316
   04659 Th17 cell differentiation
    109577316
   04672 Intestinal immune network for IgA production
    109577316
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109577316
   05322 Systemic lupus erythematosus
    109577316
   05323 Rheumatoid arthritis
    109577316
   05320 Autoimmune thyroid disease
    109577316
   05321 Inflammatory bowel disease
    109577316
   05330 Allograft rejection
    109577316
   05332 Graft-versus-host disease
    109577316
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109577316
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109577316
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109577316
   05152 Tuberculosis
    109577316
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577316
   05164 Influenza A
    109577316
   05168 Herpes simplex virus 1 infection
    109577316
   05169 Epstein-Barr virus infection
    109577316
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109577316
   05140 Leishmaniasis
    109577316
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109577316
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109577316
  Exosomal proteins of epithelial cells
   109577316
  Exosomal proteins of breast milk
   109577316
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 ig
Other DBs
NCBI-GeneID: 109577316
NCBI-ProteinID: XP_019841768
Position
23
AA seq 304 aa
MTVLLSLLLGFSLGCTAAGGFVAHVESTCVLDDDGDPKDFSYCISFNKDLLTCWDPLQAS
MIPREFGVLNGLARYLSQFLNNNSYLIQRLSNGLQNCAAHTQPFWSSLTHRTRPPTVQVA
KTTPFNTRESVMLACYVWGFYPADVAITWRRNGQEVLPHGRAWRIIQPNGDWTYQTVSHL
ATTPSFGDTYTCVVEHIGAPELILQDWSLIPGRGIETPTCCSSVADSNNNNKAESYCNSW
AVACADGEGFCGSGNAGPGSHHLRFRSAQLAESHLLRLHFPPGVHLSRRSAQLIEAEPYS
FPST
NT seq 915 nt   +upstreamnt  +downstreamnt
atgactgtcctcctgtcgctgctgctgggcttcagcctgggctgcaccgcagcaggtggt
tttgtggcacacgtggaaagcacctgtgtgttggacgatgatggggatccgaaagacttc
tcgtattgcatctccttcaacaaggatttgctgacctgctgggatcccctgcaggccagt
atgattcctcgtgaatttggggtgctgaacggcttggcccggtacctctcacagttcctc
aacaataatagttacctgatccagcgcttgtccaatggtctgcagaactgtgccgcgcac
acccagcccttctggagctctctgacccacaggacacgcccaccgaccgtgcaggtagcc
aaaaccactccttttaacacgagggagtctgtgatgctggcctgctatgtgtggggcttc
tatccagcggacgtggccatcacgtggaggaggaacgggcaggaggtcctcccacacggc
agggcctggaggatcatccagcccaacggagactggacataccagaccgtctcccatctg
gccacaaccccctcttttggggatacctacacctgtgtggtcgagcacattggggctcct
gaactcatccttcaggactggagtttgatccctggtcggggaattgagacccccacatgt
tgctctagcgtggctgacagtaacaacaacaacaaagcagagagctactgcaactcctgg
gctgttgcctgcgcagacggtgaaggtttctgtggctctggtaacgctggtcctgggtct
catcatcttcgttttcggtctgcacagttggcggagagccacctcctccggctacatttt
cctcccggggtccacttatccagaaggtcagcacaattgatagaggcagaaccctacagc
tttccctccacgtga

DBGET integrated database retrieval system